Rakbank.ae  |  RAKBANK Online Banking - Insurance, Loans, Savings/Deposit Account Dubai, UAE
Low trust score  | 
Experience the power of just one click! Check out Rak Bank new exclusive online range of banking and insurance products. It's banking on your terms. Because frankly, you want nothing less.

Rakbank.ae Website Information

Website Ranks & Scores for Rakbank.ae

Statvoo Rank Statvoo Rank:G
Alexa Rank Alexa Rank:51,086
Majestic Rank Majestic Rank:775,035
Domain Authority Domain Authority:37%
DMOZ DMOZ Listing:No

Domain Information for Rakbank.ae

Domain Registrar: UAENIC

Whois information for rakbank.ae

Full Whois Lookup for Rakbank.ae Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Rakbank.ae. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: rakbank.ae
Registrar ID: Etisalat
Registrar Name: Etisalat
Status: ok

Registrant Contact ID: CX392409T
Registrant Contact Name: National Bank of Ras Al Khaimah P.S.C
Registrant Contact Email: Visit whois.aeda.ae for Web based WhoIs
Registrant Contact Organisation: National Bank of Ras Al Khaimah P.S.C

Tech Contact ID: CX392411T
Tech Contact Name: Senior Manager
Tech Contact Email: Visit whois.aeda.ae for Web based WhoIs

Name Server: a5-65.akam.net
Name Server: a8-66.akam.net
Name Server: a20-64.akam.net
Name Server: a1-141.akam.net
Name Server: a11-66.akam.net
Name Server: a2-67.akam.net

Who hosts Rakbank.ae?

Rakbank.ae is hosted by Emirates Telecommunications Corporation in Dubai, Dubai, United Arab Emirates.
Rakbank.ae has an IP Address of and a hostname of

Rakbank.ae Web Server Information

Hosted IP Address:
Hosted Hostname:
Service Provider:Emirates Telecommunications Corporation
Hosted Country:United Arab EmiratesAE
Location Latitude:25.2582
Location Longitude:55.3047
Webserver Software:unknown
Google Map of 50,12

HTTP Header Analysis for Rakbank.ae

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 24 Jun 2015 22:01:26 GMT
Cache-Control: no-cache, no-store, must-revalidate
IBM-Web2-Location: /wps/portal/home/!ut/p/a1/04_Sj9CPykssy0xPLMnMz0vMAfGjzOLd_EMMPC2DjU38TJwtDTzNLIPcjB0tjA38zYAKIoEKDHAARwNC-sP1o8BK8JhQkBthkO6oqAgA9ag9Xw!!/dl5/d5/L2dBISEvZ0FBIS9nQSEh/
Content-Location: /wps/portal/home/!ut/p/a1/04_Sj9CPykssy0xPLMnMz0vMAfGjzOLd_EMMPC2DjU38TJwtDTzNLIPcjB0tjA38zYAKIoEKDHAARwNC-sP1o8BK8JhQkBthkO6oqAgA9ag9Xw!!/dl5/d5/L2dBISEvZ0FBIS9nQSEh/
Expires: Thu, 01 Jan 1970 00:00:00 GMT
Pragma: no-cache
Vary: User-Agent,Cookie,Accept-Encoding
Content-Encoding: gzip
Content-Type: text/html; charset=UTF-8
Content-Language: en-US
Transfer-Encoding: chunked

Need to find out who hosts Rakbank.ae?

Rakbank.ae Free SEO Report

Website Inpage Analysis for Rakbank.ae

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Rakbank.ae

xframeoptionsthisparentaddclassshadownoneifcallbackres5datatypekey 35 keycustomerwindowopenlivechaturlchatwindowlocationnotop200left200statusnoscrollbarsnoresize0dialogyeswidth750customername var customeremailsubjectdisplayusname return falsevar customeremail3callbackformformblockhidedebitfinancialalertplease enter yourenterlivechaturl livechaturlnumber returncaptcha35 keymobilefunctionbackhometrue loopsuggestions14customeremail fullname customernameitemstoolspersonal0mastercardimageelsevar livechaturlmotorselectsameoriginajaxcaptchatextcustomeremailcall backonelivecardcontactplanparamsfalse elseurlvar customernamevalid namemobilenumber512 alertplease entertermnav true looprakmoneytransferpaddingnewcimgsrcvalid name returntransferinformation toolsprepaidproductnamecustomeremail fullnameheight680directoriesnonumber return falsenav truexframeoptions sameoriginsecurealertplease selectazvar customername varreturncaptcha returndateampenter a validbranchessecurityschedule a calllivechaturl livechaturl emailnavdigitalemail customeremail fullnamecustomername varsuccessfinancecardsfeedlbackformformblockhidenamedepositwinfalse ifcaptchatextdubaikeyheaders xframeoptions sameoriginpanelbodyremoveclassshadownonecustomernamenumberheaders xframeoptionslivechaturl emailloopatm branchesnullscheduleformtriggerresetbankingvalid mobilemarginenjoyoffnoteselect anynewcaptcharakbankgetintouchdynamicwebcimgfeedbackcaptchaimg iffeedbackreskey 35enter yourreturn falseselect any productreturn false ifcaptchatextourifcallreturn false elseimportantalertplease select anysalaryloop truetrue loop truedisplay blockimmediatelytraveltextuppersonal businessname returnnull alertpleaserakbank cardsindialivechaturlwebtrendsurlnull alertplease enterfeedbacknamenewcaptcharakbankgetintouchdynamicwebcimgschedulecallbackcaptchaimgfullnamealertplease enterproducttextaccountsiffeedbackres35 key 35truecorporateloanproductalertpleasebusinessfullname customernamedigital bankingreturn false ifany productsuggestiontextinsuranceoffersblockloansnewcaptcharakbankgetintouchdynamicwebcimgfeedbackcaptchaimgrakbankatmyour suggestionsemailmobile numberenter the captchalivechaturlyourfalse ifscheduleinformationvalid mobile numberbank512 alertpleasecalldateemail customeremailnewcaptcharakbankgetintouchdynamicwebcimgschedulecallbackcaptchaimg ifcallbackresyoumoregetchatvarattribwindowopenlivechaturlchatwindowlocationnotop200left200statusnoscrollbarsnoresize0dialogyeswidth750 height680directoriesnomobile number returncaptcha return falsevalidclickifcaptchatextanyfalsefeedbackphnumberlivechaturl email customeremail2headers6callbackformformblockhide feedlbackformformblockhidemobnumber

Longtail Keyword Density for Rakbank.ae

enter a valid12
key 35 key9
35 key 359
name return false5
alertplease enter your5
valid mobile number5
return false if4
number return false3
alertplease select any3
select any product3
return false else3
headers x-frame-options sameorigin3
captcha return false3
enter the captcha3
return false ifcaptchatext3
null alertplease enter3
mobile number return3
valid name return3
email customeremail fullname3
livechaturl email customeremail3
livechaturl livechaturl email3
customername var customeremail3
customeremail fullname customername3
schedule a call3
512 alertplease enter3
true loop true3
nav true loop3
var customername var3
alertplease enter22
return false18
35 key10
key 359
mobile number6
valid name5
null alertplease5
call back5
enter your5
name return5
valid mobile5
customername var5
loop true4
newcaptcharakbank-getintouch-dynamic-webcimgschedulecallbackcaptchaimg ifcallbackres4
512 alertplease4
false if4
select any3
alertplease select3
any product3
number return3
callback-formform-blockhide feedlback-formform-blockhide3
your suggestions3
newcaptcharakbank-getintouch-dynamic-webcimgfeedbackcaptchaimg iffeedbackres3
x-frame-options sameorigin3
headers x-frame-options3
captcha return3
display block3
false else3
false ifcaptchatext3
digital banking3
email customeremail3
customeremail fullname3
livechaturl email3
livechaturl livechaturl3
var customername3
var customeremail3
fullname customername3
windowopenlivechaturlchatwindowlocationnotop200left200statusnoscrollbarsnoresize0dialogyeswidth750 height680directoriesno3
personal business3
atm branches3
information tools3
true loop3
rakbank cards3
nav true3
var livechaturl3

What are the nameservers for rakbank.ae?

Rakbank.ae Domain Nameserver Information

HostIP AddressCountry
ns1.rakbank.ae Arab Emirates United Arab Emirates
ns2.rakbank.ae Arab Emirates United Arab Emirates
ns3.rakbank.ae Arab Emirates United Arab Emirates

Rakbank.ae DNS Record Analysis DNS Lookup

rakbank.aeNS216500Target: ns1.rakbank.ae
rakbank.aeNS216500Target: ns3.rakbank.ae
rakbank.aeNS216500Target: ns2.rakbank.ae
rakbank.aeSOA600MNAME: ns1.rakbank.ae
RNAME: itopr.rakbank.ae
Serial: 2009021472
Refresh: 10800
Retry: 3600
Expire: 604800
rakbank.aeMX21600Priority: 10
Target: cluster5.eu.messagelabs.com
rakbank.aeMX21600Priority: 100
Target: mail5.rakbank.ae
rakbank.aeMX21600Priority: 110
Target: mail7.rakbank.ae
rakbank.aeMX21600Priority: 20
Target: cluster5a.eu.messagelabs.com
rakbank.aeMX21600Priority: 110
Target: mail6.rakbank.ae
rakbank.aeTXT3600TXT: v=spf1 ip4:
include:spf.messagelabs.com mx ~all

Alexa Traffic Rank for Rakbank.ae

Alexa Search Engine Traffic for Rakbank.ae