Randomhouse.de  |  Die Verlage der Verlagsgruppe Random House: Autoren, Bücher, Hörbücher, eBooks & mehr
Low trust score  | 
Verlagsgruppe Random House: Haus der Verlage, Haus der Vielfalt für Literatur, Sachbuch, Fachbuch, Kinderbücher, Ratgeber und Lebenshilfe.

Randomhouse.de Website Information

Randomhouse.de has a Low Trust Score, a Statvoo Rank of E, an Alexa Rank of 107,895, a Majestic Rank of 13,151, a Domain Authority of 81% and is not listed in DMOZ.

Randomhouse.de is hosted by Telefonica Germany GmbH & Co.OHG in Nordrhein-westfalen, Verl, Germany, 33415.
Randomhouse.de has an IP Address of 213.20.169.5 and a hostname of mucrhduweb0001.bertelsmann.de.

The domain randomhouse.de was registered 201 decades 8 years 9 months ago by , it was last modified 1 decade 1 year 5 months ago and currently is set to expire 201 decades 8 years 9 months ago.


Whois information for randomhouse.de

Full Whois Lookup for Randomhouse.de Whois Lookup

% Copyright (c) 2010 by DENIC
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%

Domain: randomhouse.de
Nserver: dns009.arvato-systems.de
Nserver: dns017.arvato-systems.de
Nserver: ns1.arvato-systems.de
Nserver: ns2.arvato-systems.de
Status: connect
Changed: 2014-07-01T13:35:22+02:00

[Tech-C]
Type: PERSON
Name: Hostmaster
Organisation: arvato systems GmbH
Address: An der Autobahn 200
PostalCode: 33333
City: Guetersloh
CountryCode: DE
Phone: +49 5241 808000
Fax: +49 5241 8068000
Email: Login to show email
2017-01-09T17:15:19+01:00

[Zone-C]
Type: PERSON
Name: Hostmaster
Organisation: arvato systems GmbH
Address: An der Autobahn 200
PostalCode: 33333
City: Guetersloh
CountryCode: DE
Phone: +49 5241 808000
Fax: +49 5241 8068000
Email: Login to show email
2017-01-09T17:15:19+01:00

Who hosts Randomhouse.de?

Randomhouse.de Web Server Information

Hosted IP Address:213.20.169.5
Hosted Hostname:mucrhduweb0001.bertelsmann.de
Service Provider:Telefonica Germany GmbH & Co.OHG
Hosted Country:GermanyDE
Location Latitude:51.8833
Location Longitude:8.51667
Webserver Software:Not Applicable

HTTP Header Analysis for Randomhouse.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 23 Jun 2015 17:31:41 GMT
Server: Apache
Content-Language: de-DE
Transfer-Encoding: chunked
Content-Type: text/html;charset=UTF-8


Need to find out who hosts Randomhouse.de?

Randomhouse.de Free SEO Report

Website Inpage Analysis for Randomhouse.de

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Randomhouse.de

meetingsautorenbestsellerschiffereinerzusicheinedesclaudia schifferverlageunshousekontaktbuchrandomverlagsgruppe random houseaufdenzum buchclaudiasiestadteinzumunterampmanneuerscheinungenrandom houseverlagsgruppeimmerimfrdasnewsletterverlagsgruppe randomratgeberweiterediederberuumlber

Longtail Keyword Density for Randomhouse.de

KeywordsOccurences
verlagsgruppe random house4
zum buch5
random house4
verlagsgruppe random4
claudia schiffer3
die11
sie6
ein6
auf5
amp5
zum5
zu5
sich5
buch5
der5
eine5
verlagsgruppe5
ber4
immer4
random4
stadt4
einer4
uumlber4
bestseller4
man4
im4
house4
neuerscheinungen4
schiffer3
claudia3
fr3
das3
kontakt3
meetings3
den3
weitere3
verlage3
ratgeber3
newsletter3
unter3
autoren3
uns3
des3

What are the nameservers for randomhouse.de?

Randomhouse.de Domain Nameserver Information

HostIP AddressCountry
dns009.arvato-systems.de 193.189.249.157Germany Germany
dns017.arvato-systems.de 84.17.190.100Germany Germany
ns1.arvato-systems.de 84.17.168.68Germany Germany
ns2.arvato-systems.de 109.235.143.148Germany Germany

Randomhouse.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Randomhouse.de is a scam?