Rapidgator

Safety: High trust score
Year Founded: 2010
Global Traffic Rank: 3,448
Estimated Worth: $5,242,320

Download file from Rapidgator. Cloud hosting solutions, safe and secure file hosting



Domain summary

Last updated
2021-04-16
Domain label
rapidgator
Domain extension
net
Domain registered:
2010-01-04
Domain updated:
2021-01-22
Global Traffic Rank
3,448
Statvoo Rating
B
Trust Score
High trust score
Estimated worth
$5,242,320
Estimated daily income
$4,854
Estimated monthly income
$147,643

Frequently Asked Questions (FAQ)

Q: When was Rapidgator.net registered?
A: Rapidgator.net was registered 12 years, 4 months, 1 week, 5 days, 21 hours, 44 minutes, 26 seconds ago on Monday, January 4, 2010.
Q: When was the WHOIS for Rapidgator.net last updated?
A: The WHOIS entry was last updated 1 year, 3 months, 3 weeks, 4 days, 21 hours, 44 minutes, 26 seconds ago on Friday, January 22, 2021.
Q: What are Rapidgator.net's nameservers?
A: DNS for Rapidgator.net is provided by the following nameservers:
  • ns1.rapidgator.net
  • ns2.rapidgator.net
  • ns3.rapidgator.net
  • ns4.rapidgator.net
  • ns5.rapidgator.net
Q: Who is the registrar for the Rapidgator.net domain?
A: The domain has been registered at INTERNET DOMAIN SERVICE BS CORP.
Q: What is the traffic rank for Rapidgator.net?
A: Rapidgator.net ranks 3,448 globally on Alexa. Rapidgator.net has a High trust score, and a Statvoo Rank of B.
Q: How many people visit Rapidgator.net each day?
A: Rapidgator.net receives approximately 606,749 visitors and 4,853,992 page impressions per day.
Q: What IP address does Rapidgator.net resolve to?
A: Rapidgator.net resolves to the IPv4 address 195.211.222.2.
Q: In what country are Rapidgator.net servers located in?
A: Rapidgator.net has servers located in the Russia.
Q: What webserver software does Rapidgator.net use?
A: Rapidgator.net is powered by Nginx webserver.
Q: Who hosts Rapidgator.net?
A: Rapidgator.net is hosted by Netvillage Ltd. in Russia.
Q: How much is Rapidgator.net worth?
A: Rapidgator.net has an estimated worth of $5,242,320. An average daily income of approximately $4,854, which is roughly $147,643 per month.

Rapidgator.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Rapidgator.net Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Rapidgator.net

H1 Headings

1 :
  1. Rapidgator

H2 Headings

2 :
  1.  
  2. Share files with your friends. No limits. Easy as ever.

H3 Headings

1 :
  1. Rapidgator - Rapid File Hosting

H4 Headings

1 :
  1. Safe & Secure

H5 Headings

1 :
  1. Rapidgator Features:

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

2 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-25516484-1

Links - Internal

27:

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Rapidgator.net

storagevare name0uploadefilesif linktypevalhtmlfunctiontypelinkfilebbcodesize1domainrgtopolicynltexthrefelsesizesinamesiifnamelinktypevalrapidgator

Who hosts Rapidgator.net?

Rapidgator.net Hosting Provider Information

Hosted IP Address:195.211.222.2
Hosted Hostname:195.211.222.2
Service Provider:Netvillage Ltd.
Hosted Country:RussiaRU
Location Latitude:55.7386
Location Longitude:37.6068
Webserver Software:nginx

Is "Netvillage Ltd." in the Top 10 Hosting Companies?

Name
Percentage
Unknown
21.9161%
GOOGLE
14.0532%
AS-26496-GO-DADDY-COM-LLC
3.4879%
NAMECHEAP-NET
3.1470%
AMAZON-AES
2.2136%
GoDaddy.com, LLC
2.0287%
UNIFIEDLAYER-AS-1
1.9645%
Fara Negar Pardaz Khuzestan
1.6143%
CONFLUENCE-NETWORK-INC
1.4660%
1&1 Internet AG
1.3358%
Netvillage Ltd.
0.0003%

HTTP Header Analysis for Rapidgator.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Fri, 16 Apr 2021 01:56:43 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-cache,must-revalidate
Pragma: no-cache
Access-Control-Allow-Origin: *
Content-Encoding: gzip
Strict-Transport-Security: max-age=63072000; includeSubDomains; preload
X-Frame-Options: SAMEORIGIN
X-XSS-Protection: 1; mode=block
X-Content-Type-Options: nosniff

Rapidgator.net Domain Nameserver Information

HostIP AddressCountry
ns1.rapidgator.net 91.197.44.119Cyprus Cyprus
ns2.rapidgator.net 91.197.44.118Cyprus Cyprus
ns3.rapidgator.net 91.197.44.117Cyprus Cyprus
ns4.rapidgator.net 91.197.44.12Cyprus Cyprus
ns5.rapidgator.net 91.197.45.4Cyprus Cyprus


Need to find out who hosts Rapidgator.net?


Domain Registration (WhoIs) information for Rapidgator.net

 Domain Name: RAPIDGATOR.NET
Registry Domain ID: 1580714783_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.internet.bs
Registrar URL: http://www.internetbs.net
Updated Date: 2021-01-22T22:31:59Z
Creation Date: 2010-01-04T10:55:22Z
Registrar Registration Expiration Date: 2023-01-04T10:55:22Z
Registrar: Internet Domain Service BS Corp.
Registrar IANA ID: 2487
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.5163015301
Reseller:
Domain Status: clientTransferProhibited - http://www.icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not disclosed
Registrant Name: Domain Admin
Registrant Organization: Whois Privacy Corp.
Registrant Street: Ocean Centre, Montagu Foreshore, East Bay Street
Registrant City: Nassau
Registrant State/Province: New Providence
Registrant Postal Code:
Registrant Country: BS
Registrant Phone: +1.5163872248
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: Not disclosed
Admin Name: Domain Admin
Admin Organization: Whois Privacy Corp.
Admin Street: Ocean Centre, Montagu Foreshore, East Bay Street
Admin City: Nassau
Admin State/Province: New Providence
Admin Postal Code:
Admin Country: BS
Admin Phone: +1.5163872248
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: Not disclosed
Tech Name: Domain Admin
Tech Organization: Whois Privacy Corp.
Tech Street: Ocean Centre, Montagu Foreshore, East Bay Street
Tech City: Nassau
Tech State/Province: New Providence
Tech Postal Code:
Tech Country: BS
Tech Phone: +1.5163872248
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Login to show email
Server: ns1.rapidgator.net
Name Server: ns2.rapidgator.net
Name Server: ns3.rapidgator.net
Name Server: ns4.rapidgator.net
Name Server: ns5.rapidgator.net
Name Server: ns6.rapidgator.net
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2021-04-16T01:53:40Z

Websites with Similar Names

Rapid--growth.com
アフィリエイターログイン|ラピッドグロース
Rapid-19.org
Repository of Aggregated Pediatric International Data on COVID-19
Rapid-ably.xyz
rapid-ably.xyz – ??????????.com??????????
Rapid-abril.com
rapid-abril.com – Cerrajería 24h
Rapid-access.cloud
Page not found at /
Rapid-accomplice.xyz
rapid-accomplice.xyz – ??????????.com??????????
Rapid-acting-insulin.com
Apidra® (insulin glulisine injection) 100 Units/mL

Recently Updated Websites

Make.com (3 minutes 25 seconds ago.)Factoriacultural.es (14 minutes 37 seconds ago.)Numanzia.com (20 minutes 15 seconds ago.)Nftcode-it.com (25 minutes 26 seconds ago.)Gurugamer.com (32 minutes 4 seconds ago.)Satta-kingn.in (38 minutes 10 seconds ago.)Z1fm.online (53 minutes 48 seconds ago.)Fesehatk.com (1 hour 12 minutes ago.)Ntinews.com (1 hour 22 minutes ago.)Blumble.com (2 hours 30 minutes ago.)Klamboe.com (3 hours 46 minutes ago.)Boot-upstrongintenselytheproduct.vip (3 hours 53 minutes ago.)Cacheeye.com (4 hours 33 minutes ago.)Sattaking-result.com (5 hours 28 minutes ago.)Sattanom.in (5 hours 31 minutes ago.)Ghostbookwriting.services (5 hours 31 minutes ago.)Satta-king.online (5 hours 32 minutes ago.)Sattaking-number.com (5 hours 34 minutes ago.)Satta-king-king.com (5 hours 36 minutes ago.)Notfcompreviews.com (5 hours 38 minutes ago.)Separatecolonist.com (5 hours 39 minutes ago.)Sattakingy.in (5 hours 39 minutes ago.)Ml.miuqf.xyz (5 hours 40 minutes ago.)Sattakingking.com (5 hours 40 minutes ago.)Sattakingindia.com (5 hours 43 minutes ago.)Www-jointrestoregummies.com (5 hours 50 minutes ago.)Pgjoker4d.com (6 hours 19 minutes ago.)Tenderly.co (6 hours 25 minutes ago.)Projeksiyoncum.com (6 hours 34 minutes ago.)Sattakingg.net (7 hours ago.)

Recently Searched Keywords

atascadero pet hospital (1 second ago.)startimes app (1 second ago.)svg height100fillrgba204 (1 second ago.)digitalartsmediagroup (1 second ago.)employment services office near me (2 seconds ago.)pulseras de piedras preciosas (2 seconds ago.)vperman150 see specs (3 seconds ago.)suzanne and walter (3 seconds ago.)vizio remote (4 seconds ago.)38-40 (5 seconds ago.)februar 2016har eu lært af krisen (5 seconds ago.)false month 3 (6 seconds ago.)charupadi (7 seconds ago.)schmiedeteile (7 seconds ago.)sub-ohm tanks (7 seconds ago.)snapshot download (10 seconds ago.)style-k2lj3daf2labelwrapper (10 seconds ago.)biggerpenisexercises (10 seconds ago.)girii yapmanz (11 seconds ago.)fbbeforewidth (12 seconds ago.)california dui breath test defenses (12 seconds ago.)stroke of midnight (13 seconds ago.)久久精品 (13 seconds ago.)grapevines meaning (14 seconds ago.)starner (14 seconds ago.)background pictures for computer winter (15 seconds ago.)cartellera (15 seconds ago.)h3colorrgb0 (15 seconds ago.)ssserif sans-serif font-weight (16 seconds ago.)phạm đoan trang (16 seconds ago.)