Rapidgator.net Summary

Rapidgator.net  |  Download file from Rapidgator. Cloud hosting solutions, safe and secure file hosting
High trust score  | 
Rapidgator: Fast, safe and secure file hosting


Rapidgator.net has a High trust score, and a Statvoo Rank of B.

Rapidgator.net is hosted by Netvillage Ltd. in Bryansk, Bryansk, Russian Federation, 241037.
Rapidgator.net has an IP Address of 195.211.221.116 and a hostname of 195.211.221.116.

The domain rapidgator.net was registered 1 decade 2 weeks 18 hours ago by INTERNET.BS CORP., it was last modified 6 years 1 month 1 week ago and currently is set to expire 2 years 1 week 4 days ago.

It is the world's 1,322 most popular site among over 300 million websites.

Rapidgator.net has a total of 0 backlinks.

Rapidgator.net gets approximately 11316184 pageviews per day.

Rapidgator.net has an estimated worth of $12221280.
An average daily income of approximately $11316, which is wroughly $344195 per month.

Whois information for rapidgator.net

Full Whois Lookup for Rapidgator.net Whois Lookup

Domain Name: RAPIDGATOR.NET
Registry Domain ID: 1580714783_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.internet.bs
Registrar URL: http://www.internet.bs
Updated Date: 2017-11-24T04:27:20Z
Creation Date: 2010-01-04T10:55:22Z
Registry Expiry Date: 2023-01-04T10:55:22Z
Registrar: Internet Domain Service BS Corp
Registrar IANA ID: 2487
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.RAPIDGATOR.NET
Name Server: NS2.RAPIDGATOR.NET
Name Server: NS3.RAPIDGATOR.NET
Name Server: NS4.RAPIDGATOR.NET
Name Server: NS5.RAPIDGATOR.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-08-19T21:01:25Z

Who hosts Rapidgator.net?

Rapidgator.net Web Server Information

Hosted IP Address:195.211.221.116
Hosted Hostname:195.211.221.116
Service Provider:Netvillage Ltd.
Hosted Country:RussiaRU
Location Latitude:53.2521
Location Longitude:34.3717
Webserver Software:Not Applicable

HTTP Header Analysis for Rapidgator.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Mon, 19 Aug 2019 21:01:35 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-cache,must-revalidate
Pragma: no-cache
Access-Control-Allow-Origin: *
Content-Encoding: gzip
X-Frame-Options: SAMEORIGIN
X-Content-Type-Options: nosniff

Need to find out who hosts Rapidgator.net?

Rapidgator.net Free SEO Report

Website Inpage Analysis for Rapidgator.net

H1 Headings:1
Rapidgator
H2 Headings:2
 
Share files with your friends. No limits. Easy as ever.
H3 Headings:1
Rapidgator - Rapid File Hosting
H4 Headings:1
Safe & Secure
H5 Headings:1
Rapidgator Features:
H6 Headings:0
Total IFRAMEs:0
Total Images:2
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Rapidgator.net

1domainrgtofunctiondoloadlinktypevalhrefrapidgatorpolicynewfiletextsizesistorageebbcodeelsee nameuploadvalue0if linktypevalhtmlvarnltypelinkifsizenamenamesifiles

Longtail Keyword Density for Rapidgator.net

KeywordsOccurences
if linktypeval4
e name3
if10
var10
name8
function7
e6
file6
rapidgator5
upload5
typelink4
linktypeval4
html4
nl4
sizesi4
href4
doload4
storage4
files4
size3
namesi3
bbcode3
else3
03
text3
domainrgto3
13
new3
policy3
value3

What are the nameservers for rapidgator.net?

Rapidgator.net Domain Nameserver Information

HostIP AddressCountry
ns1.rapidgator.net 91.197.44.119Cyprus Cyprus
ns2.rapidgator.net 91.197.44.118Cyprus Cyprus
ns3.rapidgator.net 91.197.44.117Cyprus Cyprus
ns4.rapidgator.net 91.197.44.12Cyprus Cyprus
ns5.rapidgator.net 91.197.45.4Cyprus Cyprus

Rapidgator.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Rapidgator.net is a scam?