EFRC Recip – European Forum for Reciprocating Compressors

Safety: Low trust score
Year Founded: 1999
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet



Domain summary

Last updated
2021-11-13
Domain label
recip
Domain extension
org
Domain registered:
1999-12-04
Domain updated:
2021-11-13
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Recip.org registered?
A: Recip.org was registered 21 years, 11 months, 3 weeks, 4 days, 2 hours, 48 minutes, 52 seconds ago on Saturday, December 4, 1999.
Q: When was the WHOIS for Recip.org last updated?
A: The WHOIS entry was last updated 2 weeks, 2 days, 2 hours, 48 minutes, 52 seconds ago on Saturday, November 13, 2021.
Q: What are Recip.org's nameservers?
A: DNS for Recip.org is provided by the following nameservers:
  • ns1067.ui-dns.com
  • ns1068.ui-dns.biz
  • ns1038.ui-dns.de
  • ns1089.ui-dns.org
Q: Who is the registrar for the Recip.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Recip.org?
A: Recip.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Recip.org each day?
A: Recip.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Recip.org resolve to?
A: Recip.org resolves to the IPv4 address .
Q: In what country are Recip.org servers located in?
A: Recip.org has servers located in the .
Q: What webserver software does Recip.org use?
A: Recip.org is powered by Nginx webserver.
Q: Who hosts Recip.org?
A: Recip.org is hosted by Unknown in .
Q: How much is Recip.org worth?
A: Recip.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Recip.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Recip.org Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Recip.org

H1 Headings

0 :

H2 Headings

12 :
  1. EVENTS
  2. TOPICS
  3. Conference
  4. Students
  5. R&D
  6. Training
  7. Tutorial
  8. Standardisation
  9. MEMBERS
  10. WHO WE ARE
  11. WHAT WE DO
  12. WHY BECOME A MEMBER

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

63 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-55288754-1

Links - Internal

126:

Keyword Cloud for Recip.org

efrc conferencewefunctionwidthefrc conference 2021efrctransformcookie policypaddingbottom 0pxconferenceerrgalleryzoomiconone fancyheaderdo why becomenow0px gallerycarouselshortcodegallerycarouselshortcodeidc4e62a677ed2ed02330185b7fdeccbd9 owlnavcolorpulsating flowavoidcompressor reliabilityreliability survey outphantom dtshortcodesocicons32pxdo whymedia0metermshighcontrast none gallerycarouselshortcodegallerycarouselshortcodeidc4e62a677ed2ed02330185b7fdeccbd9buoftransform translatey50 margintop5pxcanflowpaddingaorphanedshortcode26f8b2aefc80014bc7944867badea0f1hoverfancyheader wfwrap26pxgalleryourassemblywhygeneral assemblyrollovervideomarginright100px100px borderstylehtmldivinnerhtmlfindrgba25525525503 boxshadow10px44px lineheight 44pxpulsatingrollovericon fontsize 32pxmargintop 0px gallerycarouselshortcodegallerycarouselshortcodeidc4e62a677ed2ed02330185b7fdeccbd944pxfontsize 32px colorvarnew editionowlnav44px minheight 44pxbackground webkitlineargradientnews12th efrc conferencelineargradientgallerycarouselshortcodegallerycarouselshortcodeidc4e62a677ed2ed02330185b7fdeccbd9 owlnavtranslateycalc50 0pxpaddingtop 0px paddingbottompolicyborderradiussurvey outrevinitrevslider21htmldivdtshortcodesocicons aorphanedshortcode26f8b2aefc80014bc7944867badea0f150 transformgallerycarouselshortcodegallerycarouselshortcodeidc4e62a677ed2ed02330185b7fdeccbd9 owlnav aowlprevgallerycarouselshortcodegallerycarouselshortcodeidc4e62a677ed2ed02330185b7fdeccbd9repositionarrows owlnav20pxminheight 44px lineheightstrictlyffffff minwidthgallerycarouselshortcodegallerycarouselshortcodeidc4e62a677ed2ed02330185b7fdeccbd9repositionarrowsworkingsolid dtshortcodesocicons32px color fffffftutorialnone gallerycarouselshortcodegallerycarouselshortcodeidc4e62a677ed2ed02330185b7fdeccbd9 owlnav0px2margintopminheight 44pxlineheightborderradius 100px borderstylebecome a memberbordergeneralnecessarybackground rgba25525525503developmentlineheight 44pxyoudtshortcodesocicons aorphanedshortcode26f8b2aefc80014bc7944867badea0f1hoverwebkitlineargradientgallerycarouselshortcodegallerycarouselshortcodeidc4e62a677ed2ed02330185b7fdeccbd90px 0px 0pxpaddingtop 0pxmorergba2552552550336pxconference 2021fancyheaderowlnav aowlnextbackgroundvar htmldivwebsitetransform translateycalc50 0pxaowlprevassembly 2021owlnav aowlprevhgroup32px colorenablescreennewbackground noneoutcenterrecipbackground lineargradientsurveyffffff minwidth 44pxinformationsolid borderwidthborderstyleliquidsnonecolor ffffff minwidthrgba25525525503 boxshadow nonemedia allgallerycarouselshortcodegallerycarouselshortcodeidc4e62a677ed2ed02330185b7fdeccbd9 owlnav aowlnextboxshadow noneyourpaddingbottomread50 transform translateycalc50leftall and mshighcontrast0px fancyheaderdtshortcodesociconsfontsize 32px0px paddingbottommembersstrictly necessarycookierollovericon background rgba255255255031news12th efrcffffffaorphanedshortcode26f8b2aefc80014bc7944867badea0f1solid0px mediamshighcontrast nonesettingsmarginboxshadowour tutorialmaxwidthmemberoncerevslider21elsecompressorswebkitlineargradient background lineargradient44px lineheightteamminwidth 44px minheightsolid borderwidth 0pxminheightrollovericon44px minheight0px 0pxminwidth 44pxpaddingtopnews12thbecomecookiesread morereciprocatingdtshortcodesocicons aorphanedshortcode26f8b2aefc80014bc7944867badea0f1nothovertransform translatey50breadcrumbswe do whydisablescreen and maxwidthsociconfontsize 20pxwebinarmshighcontrasttransform translateycalc50doeditiontrainingminwidth100px borderstyle solidreliability surveymargintop 0pxreliabilityborderradius 100pxsaveborderstyle solid0px gallerycarouselshortcodegallerycarouselshortcodeidc4e62a677ed2ed02330185b7fdeccbd90px paddingbottom 0pxborderstyle solid borderwidthaorphanedshortcode26f8b2aefc80014bc7944867badea0f1nothoverfontsizewhy become778pxwe donone gallerycarouselshortcodegallerycarouselshortcodeidc4e62a677ed2ed02330185b7fdeccbd9err errsocfonticonbackground webkitlineargradient backgroundedition of ourreciprocating compressorsrolloverphantompage dtshortcodesociconsgallerycarouselshortcodegallerycarouselshortcodeidc4e62a677ed2ed02330185b7fdeccbd9galleryshortcodeheightmedia screenrollovericon fontsizetranslatey50 margintopalltop 50translatey50 margintop 0pxgeneral assembly 2021toppagecolor ffffffout nowborderwidthcompressorbackground rgba25525525503 boxshadowtop 50 transformguidelinesborderwidth 0pxhtmldivinnerhtml htmldivcss44px borderradiustranslatey50aowlnextcompressor reliability surveymaxwidth 778pxhtmldivcsswfwraptranslateycalc5044px borderradius 100pxrollovericon backgrounddownloadlineheight 44px borderradiusrollovervideo i backgroundavoid liquidswebkitlineargradient backgroundcookie settingsproceedings

Longtail Keyword Density for Recip.org

KeywordsOccurences
-webkit-linear-gradient background linear-gradient8
background -webkit-linear-gradient background8
44px line-height 44px7
rgba25525525503 box-shadow none7
background rgba25525525503 box-shadow7
44px border-radius 100px7
line-height 44px border-radius7
ffffff min-width 44px6
rollover-icon background rgba255255255036
solid border-width 0px6
border-style solid border-width6
100px border-style solid6
border-radius 100px border-style6
min-height 44px line-height6
44px min-height 44px6
min-width 44px min-height6
color ffffff min-width6
32px color ffffff6
font-size 32px color6
rollover-icon font-size 32px6
rollover-video i background6
screen and max-width6
all and -ms-high-contrast5
0px gallery-carousel-shortcodegallery-carousel-shortcode-id-c4e62a677ed2ed02330185b7fdeccbd9 owl-nav5
efrc conference 20214
transform translateycalc-50 0px4
become a member4
0px 0px 0px4
transform translatey-50 margin-top4
compressor reliability survey4
translatey-50 margin-top 0px4
50 transform translateycalc-504
top 50 transform4
margin-top 0px gallery-carousel-shortcodegallery-carousel-shortcode-id-c4e62a677ed2ed02330185b7fdeccbd93
none gallery-carousel-shortcodegallery-carousel-shortcode-id-c4e62a677ed2ed02330185b7fdeccbd9 owl-nav3
-ms-high-contrast none gallery-carousel-shortcodegallery-carousel-shortcode-id-c4e62a677ed2ed02330185b7fdeccbd93
we do why3
gallery-carousel-shortcodegallery-carousel-shortcode-id-c4e62a677ed2ed02330185b7fdeccbd9 owl-nav aowl-prev3
do why become3
0px padding-bottom 0px3
padding-top 0px padding-bottom3
edition of our3
general assembly 20213
reliability survey out3
news12th efrc conference3
gallery-carousel-shortcodegallery-carousel-shortcode-id-c4e62a677ed2ed02330185b7fdeccbd9 owl-nav aowl-next3
gallery-carousel-shortcodegallery-carousel-shortcode-id-c4e62a677ed2ed02330185b7fdeccbd9 owl-nav11
color ffffff10
efrc conference10
border-width 0px9
border-radius 100px8
background linear-gradient8
line-height 44px8
background -webkit-linear-gradient8
-webkit-linear-gradient background8
rgba25525525503 box-shadow7
background rgba255255255037
0px gallery-carousel-shortcodegallery-carousel-shortcode-id-c4e62a677ed2ed02330185b7fdeccbd97
box-shadow none7
font-size 32px7
44px line-height7
44px border-radius7
32px color6
ffffff min-width6
solid border-width6
min-width 44px6
rollover-icon background6
44px min-height6
border-style solid6
rollover-icon font-size6
min-height 44px6
100px border-style6
media screen6
0px 0px6
max-width 778px6
-ms-high-contrast none5
none gallery-carousel-shortcodegallery-carousel-shortcode-id-c4e62a677ed2ed02330185b7fdeccbd95
50 transform5
background none5
dt-shortcode-soc-icons aorphaned-shortcode-26f8b2aefc80014bc7944867badea0f1hover5
transform translateycalc-504
translateycalc-50 0px4
transform translatey-504
translatey-50 margin-top4
top 504
gallery-carousel-shortcodegallery-carousel-shortcode-id-c4e62a677ed2ed02330185b7fdeccbd9reposition-arrows owl-nav4
solid dt-shortcode-soc-icons4
page dt-shortcode-soc-icons4
phantom dt-shortcode-soc-icons4
dt-shortcode-soc-icons aorphaned-shortcode-26f8b2aefc80014bc7944867badea0f1nothover4
margin-top 0px4
reciprocating compressors4
htmldivinnerhtml htmldivcss4
padding-bottom 0px4
var htmldiv4
font-size 20px4
reliability survey4
compressor reliability4
conference 20214
owl-nav aowl-next3
survey out3
dt-shortcode-soc-icons aorphaned-shortcode-26f8b2aefc80014bc7944867badea0f13
we do3
out now3
why become3
do why3
err err3
cookie settings3
strictly necessary3
news12th efrc3
new edition3
general assembly3
assembly 20213
our tutorial3
pulsating flow3
media all3
avoid liquids3
padding-top 0px3
0px padding-bottom3
owl-nav aowl-prev3
0px media3
0px fancy-header3
fancy-header wf-wrap3
none fancy-header3
read more3
cookie policy3
0px39
background29
efrc25
dt-shortcode-soc-icons23
none23
44px22
owl-nav19
gallery-carousel-shortcodegallery-carousel-shortcode-id-c4e62a677ed2ed02330185b7fdeccbd918
font-size15
color14
fancy-header13
line-height12
012
var12
rollover-icon12
conference12
we11
you11
min-height10
110
ffffff10
compressor10
cookie10
border-radius10
solid10
transform10
our9
err9
media9
compressors9
border-width9
100px8
min-width8
10px8
linear-gradient8
-webkit-linear-gradient8
breadcrumbs7
all7
cookies7
box-shadow7
rollover7
32px7
rgba255255255037
padding6
htmldivcss6
rollover-video6
top6
border-style6
htmldivinnerhtml6
more6
flow6
screen6
out6
center6
padding-bottom6
working6
778px6
max-width6
26px5
recip5
new5
soc-icon5
settings5
soc-font-icon5
25
aorphaned-shortcode-26f8b2aefc80014bc7944867badea0f1hover5
margin-top5
hgroup5
20px5
-ms-high-contrast5
training4
aorphaned-shortcode-26f8b2aefc80014bc7944867badea0f1nothover4
translatey-504
general4
now4
reliability4
margin-right4
translateycalc-504
phantom4
member4
page4
become4
border4
survey4
gallery-carousel-shortcodegallery-carousel-shortcode-id-c4e62a677ed2ed02330185b7fdeccbd9reposition-arrows4
guidelines4
padding-top4
5px4
website4
else4
oncerevslider214
reciprocating4
development4
htmldiv4
proceedings4
find3
can3
do3
buof3
strictly3
aorphaned-shortcode-26f8b2aefc80014bc7944867badea0f13
necessary3
policy3
gallery-zoom-ico3
your3
save3
enable3
why3
wf-wrap3
gallery-carousel-shortcodegallery-carousel-shortcode-id-c4e62a677ed2ed02330185b7fdeccbd9gallery-shortcode3
download3
36px3
margin3
liquids3
avoid3
pulsating3
information3
read3
meter3
function3
revinitrevslider213
gallery3
aowl-next3
webinar3
tutorial3
edition3
assembly3
width3
height3
news12th3
aowl-prev3
members3
team3
left3
disable3

Who hosts Recip.org?

Recip.org Hosting Provider Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Unknown
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:nginx

Is "Unknown" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
15.7989%
GOOGLE
14.3607%
AS-26496-GO-DADDY-COM-LLC
3.8534%
NAMECHEAP-NET
3.1479%
AMAZON-AES
2.3132%
GoDaddy.com, LLC
2.0763%
UNIFIEDLAYER-AS-1
1.9874%
Fara Negar Pardaz Khuzestan
1.6407%
CONFLUENCE-NETWORK-INC
1.4732%
1&1 Internet AG
1.3797%

HTTP Header Analysis for Recip.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Sat, 13 Nov 2021 06:20:41 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 32211
Connection: keep-alive
X-Powered-By: PleskLin
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
Link:; rel="https://api.w.org/", ; rel="alternate"; type="application/json", ; rel=shortlink
Vary: Accept-Encoding
Content-Encoding: gzip

Recip.org Domain Nameserver Information

HostIP AddressCountry
ns1067.ui-dns.com 217.160.82.67
ns1068.ui-dns.biz 217.160.81.68
ns1038.ui-dns.de 217.160.80.38
ns1089.ui-dns.org 217.160.83.89


Need to find out who hosts Recip.org?


Domain Registration (WhoIs) information for Recip.org

 Domain Name: RECIP.ORG
Registry Domain ID: D5217216-LROR
Registrar WHOIS Server: whois.ionos.com
Registrar URL: https://registrar.ionos.info/
Updated Date: 2021-04-13T01:25:32Z
Creation Date: 1999-04-12T04:00:00Z
Registry Expiry Date: 2022-04-12T04:00:00Z
Registrar Registration Expiration Date:
Registrar: 1&1 IONOS SE
Registrar IANA ID: 83
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.6105601459
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization: Data Privacy Protected
Registrant State/Province: BW
Registrant Country: DE
Name Server: NS1067.UI-DNS.COM
Name Server: NS1068.UI-DNS.BIZ
Name Server: NS1038.UI-DNS.DE
Name Server: NS1089.UI-DNS.ORG
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2021-11-13T06:19:41Z

Websites with Similar Names

Recip-ease.com
recip-ease.com is coming soon
Recip.org
EFRC Recip – European Forum for Reciprocating Compressors
Recipado.com
502 Bad Gateway
Recipaedia.com
recipaedia.com - Registered at Namecheap.com
Recipage.com
Recipage

Recently Updated Websites

Thehoundbarber.online (3 seconds ago.)Nftjbrightstarhc.com (10 seconds ago.)Lakelandchamber.com (11 seconds ago.)Letiplaton.com (13 seconds ago.)Unwantedclutter.com (16 seconds ago.)Aligngi.ca (16 seconds ago.)Phdtutors.org (17 seconds ago.)Tipsychickschicago.com (21 seconds ago.)Unitedstatesofamericafromhome.com (24 seconds ago.)Roanokevalocal.com (27 seconds ago.)Mexvy.com (27 seconds ago.)Paramountlaw.net (30 seconds ago.)Asociacioncolombianadehidrogeologos.org (34 seconds ago.)Go-market.pl (34 seconds ago.)Nerloop.com (35 seconds ago.)Talktankafrica.org (39 seconds ago.)Frannow.com (40 seconds ago.)93913.com (40 seconds ago.)Krishiproducts.com (43 seconds ago.)Nahuaoral.com (49 seconds ago.)Kumez.com (50 seconds ago.)Recruitingteam.org (53 seconds ago.)Coopmerlosl.com.ar (54 seconds ago.)Birdhousebirdfeeder.com (56 seconds ago.)Anneloji.com (58 seconds ago.)Placentapro.com (59 seconds ago.)Virginaustralia.cloud (1 minute ago.)Problogstack.com (1 minute ago.)2wogoods.com (1 minute ago.)Xy22.vip (1 minute 1 second ago.)

Recently Searched Keywords

حضور ۳۰۰ نفر از مدیران و کارشناسان آماد و پشتیبانی ناجا در مرزهای چهارگانه کشور (1 second ago.)x62ex627x646x648x627x62fx647 (1 second ago.)germinal (1 second ago.)xquery (2 seconds ago.)caixa de telefone (2 seconds ago.)سفر روحانی به نیویورک، نشانه منزوی نبودن ایران (3 seconds ago.)ph-bum (4 seconds ago.)us dollar index (7 seconds ago.)تشییع پیکر ۲ شهید سانحه هوایی (7 seconds ago.)10 3 (7 seconds ago.)êtes-vous une mère carriériste  (7 seconds ago.)x62fx648x631x647 (8 seconds ago.)umm al quwain beach hotel (8 seconds ago.)juanita (10 seconds ago.)keep going (11 seconds ago.)both clubs have (11 seconds ago.)gu5.3 led bulbs (14 seconds ago.)2 years ago (14 seconds ago.)menschland (14 seconds ago.)vé số (15 seconds ago.)seo ye ji pacar posesif (15 seconds ago.)important font-size 17px (15 seconds ago.)the experience report (15 seconds ago.)hubs such (15 seconds ago.)giao meaning (17 seconds ago.)kuluumlbuuml (17 seconds ago.)derbi stx 150 (17 seconds ago.)机械服务和支持 (18 seconds ago.)yaki (18 seconds ago.)by-laws (19 seconds ago.)