UK Business Directory. Search for Local Companies & Services

Safety: Low trust score
Year Founded: 21
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-24
Category: This site has not been categorized yet

UK online business directory offering detailed listings of local companies with reviews.


Domain summary

Domain label
recommendedcompany
Domain extension
co.uk
Domain registered:
21-Feb-2010
Domain updated:
20-Feb-2019
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is recommendedcompany.co.uk ranked relative to other sites:

Percentage of visits to recommendedcompany.co.uk from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Recommendedcompany.co.uk registered?
A: Recommendedcompany.co.uk was registered 11 years, 2 weeks, 1 day, 8 hours, 36 minutes, 25 seconds ago on Sunday, February 21, 2010.
Q: When was the WHOIS for Recommendedcompany.co.uk last updated?
A: The WHOIS entry was last updated 2 years, 2 weeks, 2 days, 8 hours, 36 minutes, 25 seconds ago on Wednesday, February 20, 2019.
Q: What are Recommendedcompany.co.uk's nameservers?
A: DNS for Recommendedcompany.co.uk is provided by the following nameservers:
  • ns3.businessad.biz
  • ns4.businessad.biz
Q: Who is the registrar for the Recommendedcompany.co.uk domain?
A: The domain has been registered at Nominet UK.
Q: What is the traffic rank for Recommendedcompany.co.uk?
A: Recommendedcompany.co.uk has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Recommendedcompany.co.uk each day?
A: Recommendedcompany.co.uk receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Recommendedcompany.co.uk resolve to?
A: Recommendedcompany.co.uk resolves to the IPv4 address 167.160.175.233.
Q: In what country are Recommendedcompany.co.uk servers located in?
A: Recommendedcompany.co.uk has servers located in the United States.
Q: What webserver software does Recommendedcompany.co.uk use?
A: Recommendedcompany.co.uk is powered by Apache webserver.
Q: Who hosts Recommendedcompany.co.uk?
A: Recommendedcompany.co.uk is hosted by QuadraNet, Inc in Illinois, Elk Grove Village, United States, 60007.
Q: How much is Recommendedcompany.co.uk worth?
A: Recommendedcompany.co.uk has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Recommendedcompany.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Recommendedcompany.co.uk Free SEO Report

Website Inpage Analysis for Recommendedcompany.co.uk

H1 Headings

1 :
  1. Find a Recommended Company

H2 Headings

0 :

H3 Headings

1 :
  1. Recommended Businesses

H4 Headings

0 :

H5 Headings

23 :
  1. Thistle Locks and Alarms
  2. Elegant Beauty Clinic
  3. Urban Tiles Ltd
  4. Clifton Practice Hypnotherapy Training Sheffield
  5. Shiny Windows
  6. Birmingham Limo Hire & Sports Car Rental
  7. Il Gusto Italian Restaurant Paddington
  8. Knotty Ash
  9. Coastline Facilities Support Services Ltd
  10. Manor Pest Control
  11. Albion Forest
  12. S & B Fencing
  13. Vape lagoon
  14. Franze & Evans Cafe Shoreditch
  15. Joycey Gas
  16. One Driving Solution
  17. Ayrshire Golf Tours
  18. Best Buy To Let Mortgages
  19. SOKA Studio Ltd
  20. CS Distro
  21. Latest Reviews
  22. Latest Quotes
  23. Local Directories

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

40 :

Google Adsense

:
pub-5989885929616131

Google Analytics

:
Not Applicable

Links - Internal

213:

Links - Internal (nofollow)

22:

Links - Outbound (nofollow)

0:

Keyword Cloud for Recommendedcompany.co.uk

hassign upcoursefriendly servicealsogardenrestaurantlocksengland rsaquo hampshirerecommendednew careerfreevapehypnotherapybirminghamhaddining rsaquofamily runmortgagesgutterbeenmyupwaspscameget freebutyorkshirealbion forestgusto italian restaurantfencingmidlandstrainingdirectorygaslovelyitalian restaurantlocalitaliangustoglasgowmarkbestrsaquo hampshireenglandofferinggoodamp dining rsaquoexperiencepest controlcustomersifgetrunnbsp wewouldeast englandrsaquo hampshire rsaquowebsitessupplyhampshireneedreviewsperfectnbspif youfitbusinessforestrightengland rsaquomortgagesortedcarfriendlyhavefoundcleaninggolfwest englandrsaquoyoultdrecommended nbspyearseastallgarden rsaquotilesoverilnestwemostfamilymerseysidedrivingwestourcompanieswasps nestcontrolil gustomidlands rsaquoampbeautyeast england rsaquobusiness directoryhumbersouthsignservicenewcanpestfamily run businessamp diningwest midlandsamp garden rsaquodiningyourgusto italianprovidehampshire rsaquoalbionbasedrun businessltdrecommendedcleaning servicesforest mortgagesalbion forest mortgagesamp gardenwindowfinanciallondonoutcommercialwest england rsaquocareerpaddingtonprovidingwhichukservices

Longtail Keyword Density for Recommendedcompany.co.uk

KeywordsOccurences
amp garden rsaquo8
east england rsaquo5
amp dining rsaquo4
west england rsaquo3
gusto italian restaurant3
family run business3
england rsaquo hampshire3
rsaquo hampshire rsaquo3
albion forest mortgages3
england rsaquo9
east england8
amp garden8
garden rsaquo8
west england5
midlands rsaquo5
italian restaurant5
family run4
amp dining4
dining rsaquo4
business directory4
pest control3
hampshire rsaquo3
wasps nest3
rsaquo hampshire3
run business3
albion forest3
west midlands3
il gusto3
gusto italian3
get free3
cleaning services3
new career3
if you3
ltdrecommended nbsp3
friendly service3
nbsp we3
sign up3
forest mortgages3
rsaquo54
amp31
nbsp20
we18
business16
you16
england14
west12
services10
your10
service9
cleaning9
east9
our9
italian9
have9
midlands8
garden8
mortgage7
driving7
vape7
friendly6
out6
new6
free6
local6
london6
all5
family5
had5
restaurant5
pest5
get5
gusto5
dining5
years5
birmingham4
sorted4
run4
directory4
paddington4
uk4
training4
been4
sign4
up4
hypnotherapy4
companies4
reviews4
beauty4
came4
golf4
based4
gas3
experience3
merseyside3
hampshire3
glasgow3
can3
customers3
fencing3
financial3
providing3
wasps3
mark3
nest3
but3
albion3
forest3
mortgages3
need3
control3
window3
over3
right3
recommended3
offering3
websites3
locks3
supply3
also3
fit3
my3
tiles3
ltdrecommended3
has3
if3
career3
humber3
perfect3
south3
yorkshire3
course3
found3
commercial3
gutter3
provide3
good3
car3
il3
most3
lovely3
which3
best3
would3

Who hosts Recommendedcompany.co.uk?

Recommendedcompany.co.uk Hosting Provider Information

Hosted IP Address:167.160.175.233
Hosted Hostname:businessad.biz
Service Provider:QuadraNet, Inc
Hosted Country:United StatesUS
Location Latitude:42.0048
Location Longitude:-87.9954
Webserver Software:Apache

Is "QuadraNet, Inc" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
38.7768%
GoDaddy.com, LLC
20.0663%
Namecheap, Inc.
9.8730%
Confluence Networks Inc
6.3707%
Google Inc.
6.0392%
Merit Network Inc.
4.3939%
Amazon.com, Inc.
4.2919%
1&1 Internet AG
4.2685%
Fara Negar Pardaz Khuzestan
3.8053%
Cogent Communications
3.5576%
QuadraNet, Inc
0.2379%

HTTP Header Analysis for Recommendedcompany.co.uk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 24 Oct 2020 03:30:48 GMT
Server: Apache
X-Powered-By: PHP/5.6.27
Expires: Mon, 26 Jul 1997 05:00:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Content-Encoding: gzip
Vary: Accept-Encoding
Last-Modified: Sat, 24 Oct 2020 03:30:48 GMT
Transfer-Encoding: chunked
Content-Type: text/html; charset=ISO-8859-1

Recommendedcompany.co.uk Domain Nameserver Information

HostIP AddressCountry
ns3.businessad.biz 167.160.175.233
ns4.businessad.biz 167.160.175.233


Need to find out who hosts Recommendedcompany.co.uk?


Domain Registration (WhoIs) information for Recommendedcompany.co.uk

 Domain name:
recommendedcompany.co.uk

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 10-Dec-2012

Registrar:
123-Reg Limited t/a 123-reg [Tag = 123-REG]
URL: http://www.123-reg.co.uk

Relevant dates:
Registered on: 21-Feb-2010
Expiry date: 21-Feb-2021
Last updated: 20-Feb-2019

Registration status:
Registered until expiry date.

Name servers:
ns3.businessad.biz
ns4.businessad.biz

WHOIS lookup made at 16:45:13 27-Jun-2020

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2020.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at https://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Websites with Similar Names

Recom-international.com
AC/DC - DC/DC: Strom- & Spannungswandler Hersteller | RECOM
Recom-kreativ.com
EK Holding – Just another WordPress site
Recom-mm.com
403 Forbidden
Recom-shop.eu
RECOM - Thieme.de - Thieme Webshop
Recom.ai
Recom.ai - Upselling & Cross-selling App for Ecommerce
Recom.club
Срок регистрации домена истёк
Recom.com
recom.com is available for purchase - Sedo.com
Recom.digital
Index of /
Recom.gr
Operations Automation Default Page
Recom.kz
Стеллажи в Алматы. Купить стеллажи для склада, магазина. Низкая цена

Recently Updated Websites

Turkishmadein.xyz (2 seconds ago.)Betterafteryou.com (5 seconds ago.)Haisch-bau.de (5 seconds ago.)Imdoingme.com (5 seconds ago.)Djtahp.com (6 seconds ago.)G2pkg.rest (7 seconds ago.)Profinas.com (7 seconds ago.)Tmsyadmin.com (7 seconds ago.)Pitchmeatvshow.net (8 seconds ago.)Cityofmilfordtx.com (8 seconds ago.)Poshblanket.com (9 seconds ago.)Wildwestphotos.us (9 seconds ago.)Aiogmt.cam (9 seconds ago.)Cloturesregional.com (10 seconds ago.)Amypettingill.com (10 seconds ago.)Cybersecuritystocks.com (10 seconds ago.)Buyziphinge.com (12 seconds ago.)Homeecohs.com (12 seconds ago.)888zrwanjia.com (12 seconds ago.)Nestle-family.com (12 seconds ago.)Battleofthekingdoms.com (13 seconds ago.)1wad.top (14 seconds ago.)Blupepper.asia (14 seconds ago.)Caliwali.com (14 seconds ago.)Energiemarketplace.online (15 seconds ago.)Errclyvbj.club (16 seconds ago.)Couchtasche.com (16 seconds ago.)Galapagostortugabay.net (17 seconds ago.)Illumin8marketing.com (18 seconds ago.)Chiryo-in.com (18 seconds ago.)

Recently Searched Keywords

youtube ελληνικα παραμυθια τα τρια γουρουνακια (1 second ago.)grouphdfalseip0op376st0bm0ddd0ind9ty4nmshape (1 second ago.)geburtstagswnsche sms (2 seconds ago.)personal improvement (3 seconds ago.)تحميل التطبيقات المجانية للاندرويد (3 seconds ago.)lake fork (4 seconds ago.)shape recthdfalsetystca0k0945097979377001960800021300039220001181ix3oa0k100ix4wa0k0ix5lc1lj1ml4bm0nmstroke 1mnadbe (4 seconds ago.)ammy virk dj song (5 seconds ago.)hotels otelclk (5 seconds ago.)小儿厌食的推拿治疗 (6 seconds ago.)rgb1 116 199 (6 seconds ago.)otelclk ve turzm (6 seconds ago.)quạt sưởi xiaomi smartmi (7 seconds ago.)rn type linkrn (8 seconds ago.)grouphdfalseip0op376st0bm0ddd0ind7ty4nmshape layer (8 seconds ago.)реєстрація тов онлайн (8 seconds ago.)vector grouphdfalseip0op376st0bm0ddd0ind9ty4nmshape (9 seconds ago.)mit a.t.u sicher durch die kalte jahreszeit (9 seconds ago.)madde bağımlılığı ekşi (10 seconds ago.)chế biến cá bò khô nướng hay rán ngon nhất (10 seconds ago.)shape grouphdfalsenmenp3cix2bm0ix1mnadbe (10 seconds ago.)her şey dahil (11 seconds ago.)питерский сплин, уже четверть века радующий поклонников русского рока, приедет в израиль с. (12 seconds ago.)zephyrhills (13 seconds ago.)shadow-0003ix3va0k135ix3ty0nmdistancemnadbe drop (13 seconds ago.)chế biến cá bò khô nướng hay rán ngon nhất (13 seconds ago.)wczesne poronienie podczas okresu (14 seconds ago.)drop shadow-0005ix5va0k5ix5ty7nmshadow (14 seconds ago.)arte dramatico tenerife (14 seconds ago.)rampmnadbe ramp-0003ix3va0k149127ix3ty2nmend colormnadbe (15 seconds ago.)