Redbrick | The official student newspaper of the University of Birmingham

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: 348,878
Estimated Worth: $10,080
Last updated:2020-10-27

Redbrick is the University of Birmingham's student newspaper


Domain summary

Domain label
redbrick
Domain extension
me
Global Traffic Rank
348,878
Statvoo Rating
G
Trust Score
Low Trust Score
Estimated worth
$10,080
Estimated daily income
$28
Estimated monthly income
$852

Rank summary

How is redbrick.me ranked relative to other sites:

Percentage of visits to redbrick.me from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Redbrick.me registered?
A: Redbrick.me was registered 3 months, 4 weeks, 1 day, 16 hours, 11 minutes, 39 seconds ago on Tuesday, October 27, 2020.
Q: When was the WHOIS for Redbrick.me last updated?
A: The WHOIS entry was last updated 3 months, 4 weeks, 1 day, 16 hours, 11 minutes, 39 seconds ago on Tuesday, October 27, 2020.
Q: What are Redbrick.me's nameservers?
A: DNS for Redbrick.me is provided by the following nameservers:
  • ns2.digitalocean.com
  • ns1.digitalocean.com
  • ns3.digitalocean.com
Q: Who is the registrar for the Redbrick.me domain?
A: The domain has been registered at .
Q: What is the traffic rank for Redbrick.me?
A: Redbrick.me ranks 348,878 globally on Alexa. Redbrick.me has a Low Trust Score, and a Statvoo Rank of G.
Q: How many people visit Redbrick.me each day?
A: Redbrick.me receives approximately 3,065 visitors and 9,195 page impressions per day.
Q: What IP address does Redbrick.me resolve to?
A: Redbrick.me resolves to the IPv4 address 139.59.196.190.
Q: In what country are Redbrick.me servers located in?
A: Redbrick.me has servers located in the United Kingdom.
Q: What webserver software does Redbrick.me use?
A: Redbrick.me is powered by Nginx/1.14.0 (Ubuntu) webserver.
Q: Who hosts Redbrick.me?
A: Redbrick.me is hosted by TeliaSonera AB in England, London, United Kingdom, Sl1.
Q: How much is Redbrick.me worth?
A: Redbrick.me has an estimated worth of $10,080. An average daily income of approximately $28, which is roughly $852 per month.

Redbrick.me Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Redbrick.me Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Redbrick.me

H1 Headings

59 :
  1. Students Frustrated By Gym Bookings
  2. COVID-19 cases surge at UoB
  3. University COVID Lab Boosts Local Testing Capacity
  4. UoB Deny Staff Opportunity To Work Remotely
  5. Twitter Suspends Accounts Claiming to be Black Trump Supporters, But is it Too Late?
  6. A Deep Dive Into QAnon: The Conspiracy Threatening US Democracy
  7. Supreme Court Nomination: Is a Constitutional Crisis On The Cards?
  8. A Detriment to Donald Trump?: The Online Presidential Debate
  9. Spotlight On: Fons Americanus by Kara Walker
  10. Book Wormhole: Girl, Woman, Other by Bernadine Evaristo
  11. Review: Van Gogh Alive
  12. Review: The End of Fun! at IKON
  13. Essential Albums: Queen – The Works
  14. A Beginner’s Guide To: Lausse the Cat
  15. Black History Month: Celebrating Black Artists
  16. Classic Single Review: Van Halen – Eruption
  17. Review: A Love Song for Latasha
  18. Casting James Bond
  19. Review: Bill & Ted Face the Music
  20. Review: The New Mutants
  21. Throwback Shows: The Fresh Prince of Bel-Air
  22. Throwback Shows: Misfits
  23. Review: The Haunting of Bly Manor
  24. Has Matt Lucas Ruined The Great British Bake Off?
  25. Paradise Killer Review
  26. Will an Increase In The Price Of Games Impact Gaming as a Hobby?
  27. Steve, Alex, Zombie and Enderman from Minecraft Join Smash Bros. Ultimate
  28. Super Mario 3D All-Stars Review
  29. Review: Nandos ‘The Imitator’ Plant-Based Alternative
  30. A Guide to Buying Wine: How to See Beyond the Label
  31. Rundown, Reflection and Review: Eat Out to Help Out
  32. Editors’ Review: Pho
  33. Travel Editors: Reminiscing on My Last Holiday
  34. A Staycation in the South-West
  35. One for the Bucket List: Canada
  36. Year Abroad Series: Top Tips
  37. Buying Clothes Ethically: The Lost Stock Initiative
  38. How To: Vintage Kilo Sale
  39. Redbrick’s Advice for Freshers
  40. Zero Waste, Zero Effort: Small Lifestyle Changes to Make A Big Impact
  41. New Antibiotic Discovered Using AI Technology
  42. Will Your Death be the Death of the Planet?
  43. The Valuable 500: Accessible Tech
  44. Creature Feature: The Blanket Octopus
  45. Is Formula 1 Facing a Bleak Future?
  46. Nations League Negativity Continues
  47. Cricket Facing Uncertain Future After Bizarre Summer
  48. Match Report: Birmingham Tigers UoB 3-5 Norton Canes
  49. Climate Change Strikes Again As Greenland’s Ice Shelf Collapses
  50. Twitter Suspends Accounts Claiming to be Black Trump Supporters, But is it Too Late?
  51. Students Frustrated By Gym Bookings
  52. Essential Albums: Queen – The Works
  53. News
  54. Latest
  55. Comment
  56. Features
  57. Sport
  58. Connect
  59. ISSUE 1517

H2 Headings

2 :
  1. Trending
  2. 20th March 2020

H3 Headings

21 :
  1. UoB’s International Student Income Could Drop by £80 Million
  2. UoB Develop Changes to Course Delivery due to COVID-19
  3. Bill Passes Revoking EU Freedom of Movement
  4. Climate Change Strikes Again As Greenland’s Ice Shelf Collapses
  5. Review: A Love Song for Latasha
  6. Essential Albums: Queen – The Works
  7. Swearing Parrots: The Science Behind Their Genius
  8. A Beginner’s Guide To: Lausse the Cat
  9. Twitter Suspends Accounts Claiming to be Black Trump Supporters, But is it Too Late?
  10. A Deep Dive Into QAnon: The Conspiracy Threatening US Democracy
  11. Supreme Court Nomination: Is a Constitutional Crisis On The Cards?
  12. Redbrick x Writer’s Bloc: Andromeda
  13. Food&Drink and Travel: The Best Places to Eat Worldwide
  14. International Women’s Day: Unsung Heroines
  15. The Biographies of Nobel Prize Winners
  16. Is Formula 1 Facing a Bleak Future?
  17. Nations League Negativity Continues
  18. Cricket Facing Uncertain Future After Bizarre Summer
  19. Student Conversations: UoB’s Shambolic Treatment of Language Students
  20. The Role of Social Media in Black Lives Matter
  21. Review: The Haunting of Bly Manor

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

75 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-21696987-1

Links - Internal

149:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Redbrick.me

newstrump supporters butformula 1criticltblack trump supporterswppwidgetimageslengthlt backtooalbumsblackfuturevartravelitswppimageslengthiftopsupporterslaussenationswriterimpactsummerworksif wppimageslengthlausse the catshelfcourt nominationcourtessentialice shelfbillcatcovid19gamingguideconstitutionalclaimingreviewcomment writerrecentlettrumplt back allfeaturestvtoo late8211 the workssport writerback allqueenredbrickiceintoalbums queensuspends accounts claimingher2birminghamtrump supportersfunctionsupreme court nominationstudentleaguehasformulabutwppwidgetimagesnewqueen 8211exploresdivesportif wppwidgetimageslengthsuspendsback1cricketuswppobserveimgslateessential albumseditoraccounts claimingfacingwppwidgetslengthallsupporters butsupreme courtalbums queen 8211gtyearessential albums queenlifestyleqanonmusicagainstudentsinternationaltwitter suspendsuobuniversity0black trumpnations leaguereviewsfunction wppobserveimgstwitter suspends accountscampussuspends accountstwitterjlatashacommentsupremeaccountswppwidgetsfilmbestdiscussesknomination

Longtail Keyword Density for Redbrick.me

KeywordsOccurences
lt back all12
black trump supporters4
twitter suspends accounts3
suspends accounts claiming3
trump supporters but3
supreme court nomination3
essential albums queen3
albums queen 82113
8211 the works3
lausse the cat3
lt back12
back all12
black trump4
trump supporters4
if wppwidgetimageslength4
accounts claiming3
formula 13
if wppimageslength3
function wppobserveimgs3
sport writer3
comment writer3
ice shelf3
nations league3
queen 82113
suspends accounts3
albums queen3
twitter suspends3
court nomination3
supreme court3
too late3
supporters but3
essential albums3
review17
if14
all13
gt12
back12
lt12
sport9
news9
travel8
features8
comment8
redbrick7
reviews7
let7
black7
function6
music6
university6
writer6
06
students6
wppwidgetslength6
its5
facing5
us5
international5
trump5
uob5
var5
film5
wppwidgetimageslength5
explores4
critic4
14
future4
cricket4
year4
has4
new4
wppwidgetimages4
wppimageslength4
works4
accounts4
essential4
tv4
supporters4
covid-194
twitter4
albums3
recent3
editor3
but3
discusses3
best3
claiming3
her3
wppwidgets3
suspends3
late3
campus3
birmingham3
wppobserveimgs3
lifestyle3
gaming3
j3
too3
shelf3
student3
impact3
constitutional3
guide3
lausse3
cat3
top3
latasha3
bill3
nomination3
court3
supreme3
queen3
qanon3
formula3
23
into3
dive3
nations3
league3
summer3
again3
ice3
k3

Who hosts Redbrick.me?

Redbrick.me Hosting Provider Information

Hosted IP Address:139.59.196.190
Hosted Hostname:139.59.196.190
Service Provider:TeliaSonera AB
Hosted Country:United KingdomGB
Location Latitude:51.5353
Location Longitude:-0.6658
Webserver Software:nginx/1.14.0 (Ubuntu)

Is "TeliaSonera AB" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
15.4872%
GoDaddy.com, LLC
9.2224%
Namecheap, Inc.
3.8991%
Google Inc.
2.8555%
Confluence Networks Inc
2.6870%
Amazon.com, Inc.
1.9936%
Merit Network Inc.
1.8570%
1&1 Internet AG
1.8247%
TOT Public Company Limited
1.6908%
Squarespace, Inc.
1.5625%
TeliaSonera AB
0.1064%

HTTP Header Analysis for Redbrick.me

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Server: nginx/1.14.0 (Ubuntu)
Date: Tue, 27 Oct 2020 10:53:00 GMT
Content-Type: text/html
Content-Length: 194
Connection: keep-alive
Location: https://www.redbrick.me/
Strict-Transport-Security: max-age=31536000; includeSubDomains

Redbrick.me Domain Nameserver Information

HostIP AddressCountry
ns2.digitalocean.com 173.245.59.41
ns1.digitalocean.com 173.245.58.51
ns3.digitalocean.com 198.41.222.173


Need to find out who hosts Redbrick.me?


Domain Registration (WhoIs) information for Redbrick.me

Websites with Similar Names

Redbr4ain.shop
redbr4ain.shop -&nbspThis website is for sale! -&nbspredbr4ain Resources and Information.
Redbr5ain.shop
redbr5ain.shop -&nbspThis website is for sale! -&nbspredbr5ain Resources and Information.
Redbra.in
redbra.in die Internetagentur für maßgeschneiderte Lösungen redbra.in Internetagentur
Redbra8in.shop
redbra8in.shop -&nbspThis website is for sale! -&nbspredbra8in Resources and Information.
Redbra8n.shop
redbra8n.shop -&nbspThis website is for sale! -&nbspredbra8n Resources and Information.
Redbra9in.shop
redbra9in.shop -&nbspThis website is for sale! -&nbspredbra9in Resources and Information.
Redbra9n.shop
redbra9n.shop -&nbspThis website is for sale! -&nbspredbra9n Resources and Information.
Redbraain.shop
redbraain.shop -&nbspThis website is for sale! -&nbspredbraain Resources and Information.
Redbraceinc.com
Redbrace is now West Edge Collective!
Redbrackethub.com
Practice Management and Collaboration Software for Architects: Redbracket HUB

Recently Updated Websites

Haguemarine.fr (12 seconds ago.)Momoneymarketing.com (13 seconds ago.)Nursingscrubsshop.com (13 seconds ago.)Gredy.com (14 seconds ago.)Awachi.com (17 seconds ago.)Cerias.com (18 seconds ago.)Jure.net (19 seconds ago.)Desertdeli.com (21 seconds ago.)Bicyclespy.net (22 seconds ago.)Medlar.net (26 seconds ago.)Lifestylekarma.com (31 seconds ago.)Enterprise-architects.tv (35 seconds ago.)Iconboutique.com (37 seconds ago.)Unpatentable.com (38 seconds ago.)Ecodesertmorocco.com (43 seconds ago.)T2a2.com (44 seconds ago.)Urbanstore.com (44 seconds ago.)Zhglt.xyz (47 seconds ago.)Omarlopezbejerano.com (48 seconds ago.)Iprny.com (49 seconds ago.)Bier.best (51 seconds ago.)Semikart.in (51 seconds ago.)Hugyoga.com (53 seconds ago.)4debthelpnow.com (57 seconds ago.)Toyotakudus.my.id (1 minute ago.)Okiali.club (1 minute 1 second ago.)Customerastonishment.com (1 minute 2 seconds ago.)Lavoz.net (1 minute 4 seconds ago.)Aqualabscosmetics.com (1 minute 6 seconds ago.)Avtex.mobi (1 minute 9 seconds ago.)

Recently Searched Keywords

our services digital marketing facebook,linkedin promption election campaigning youtube,tiktok,twitter etc. (2 seconds ago.)customer care 8605 (2 seconds ago.)pantalla 2020-08-24 (3 seconds ago.)meng-upload (4 seconds ago.)calories in vodka club soda drink (4 seconds ago.)sectorul (4 seconds ago.)puid7 puid8 puid9 (6 seconds ago.)sourires et vacances (11 seconds ago.)equal (14 seconds ago.)rating (16 seconds ago.)get demoted into cannon fodder (16 seconds ago.)belgian shepherd (17 seconds ago.)по дорогам восточного полесья (однодневный экскурсионный тур) (19 seconds ago.)n color var--link-color (20 seconds ago.)8x26mm dekoratif profiller (21 seconds ago.)cositor (22 seconds ago.)tiktok httpsvmtiktokcom7j8q7m (23 seconds ago.)这事有影呒 (24 seconds ago.)dolly pro src (25 seconds ago.)europe, middle east, & africa (26 seconds ago.)has new research (27 seconds ago.)diğer bağlantı elemanları (27 seconds ago.)people in history (28 seconds ago.)the cutting-edge of defense (29 seconds ago.)egypt (31 seconds ago.)dvd (31 seconds ago.)goertzel by new (33 seconds ago.)free read more (34 seconds ago.)how do keylock switches work (36 seconds ago.)currentajaxrequest (45 seconds ago.)