Domain summary

Last updated
2020-10-10
Domain label
redcomm
Domain extension
co.id
Global Traffic Rank
298,989
Statvoo Rating
G
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Redcomm.co.id registered?
A: Redcomm.co.id was registered 8 months, 1 week, 1 day, 7 hours, 4 minutes, 59 seconds ago on Saturday, October 10, 2020.
Q: When was the WHOIS for Redcomm.co.id last updated?
A: The WHOIS entry was last updated 8 months, 1 week, 1 day, 7 hours, 4 minutes, 59 seconds ago on Saturday, October 10, 2020.
Q: Who is the registrar for the Redcomm.co.id domain?
A: The domain has been registered at .
Q: What is the traffic rank for Redcomm.co.id?
A: Redcomm.co.id ranks 298,989 globally on Alexa. Redcomm.co.id has a Low Trust Score, and a Statvoo Rank of G.
Q: How many people visit Redcomm.co.id each day?
A: Redcomm.co.id receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Redcomm.co.id resolve to?
A: Redcomm.co.id resolves to the IPv4 address 103.20.91.86.
Q: In what country are Redcomm.co.id servers located in?
A: Redcomm.co.id has servers located in the Indonesia.
Q: What webserver software does Redcomm.co.id use?
A: Redcomm.co.id is powered by Apache webserver.
Q: Who hosts Redcomm.co.id?
A: Redcomm.co.id is hosted by Wow Internet Indonesia in East Java, Surabaya, Indonesia.
Q: How much is Redcomm.co.id worth?
A: Redcomm.co.id has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Redcomm.co.id Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Redcomm.co.id Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Redcomm.co.id

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

13 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-133910621-1

Links - Internal (nofollow)

0:

Links - Outbound

4:

Links - Outbound (nofollow)

0:

Keyword Cloud for Redcomm.co.id

inputswalelse0 swaldigital marketingswal pleaseinput your0 swal pleasecurrentbackgroundtinggicarrercontactyouremailclientsmarketingideawarningagencyplease inputcontactform0warning elseplease input yourvarbrandsdigitalnamedigital agencyswal please inputplease

Who hosts Redcomm.co.id?

Redcomm.co.id Hosting Provider Information

Hosted IP Address:103.20.91.86
Hosted Hostname:server.redcomm-betatest.com
Service Provider:Wow Internet Indonesia
Hosted Country:IndonesiaID
Location Latitude:-7.2484
Location Longitude:112.7419
Webserver Software:Apache

Is "Wow Internet Indonesia" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.1842%
AS-26496-GO-DADDY-COM-LLC
4.0884%
NAMECHEAP-NET
3.5315%
GoDaddy.com, LLC
2.6631%
AMAZON-AES
2.5761%
UNIFIEDLAYER-AS-1
2.1530%
Fara Negar Pardaz Khuzestan
1.9418%
Unknown
1.8112%
1&1 Internet AG
1.6678%
CONFLUENCE-NETWORK-INC
1.6554%
Wow Internet Indonesia
0.0005%

HTTP Header Analysis for Redcomm.co.id

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 10 Oct 2020 10:18:27 GMT
Server: Apache
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Redcomm.co.id Domain Nameserver Information

HostIP AddressCountry
UnknownUnknownUnknownUnknown


Need to find out who hosts Redcomm.co.id?


Domain Registration (WhoIs) information for Redcomm.co.id

Websites with Similar Names

Redco.com
Redco Audio - Audio/Video Supplies and Accessories, Custom Cables and Panels, and more
Redco.com.au
Redco Investments. Developing tomorrow's Territory today
Redco.com.co
RedCo – La Red del Comercio para los Colombianos
Redco.top
Watch movies online for free movie download at Movie2k.to Movie4k.to
Redcoach.com
Red Coach Inn | Historic Bed & Breakfast Hotel in Niagara Falls, NY – USA

Recently Updated Websites

Ammoavailable.com (2 seconds ago.)Chrissyprints.com (6 seconds ago.)Skwat.info (6 seconds ago.)Tellermeer.net (8 seconds ago.)Som.world (9 seconds ago.)2bizbox.cn (9 seconds ago.)Vrolijk-pasen.nl (10 seconds ago.)Spherefluidics.com (13 seconds ago.)Geocachingtips.com (13 seconds ago.)Jxc135.com (14 seconds ago.)Placearg.com (16 seconds ago.)Alotofmovingparts.com (16 seconds ago.)Paramparikmela.com (16 seconds ago.)Desdelser.com (16 seconds ago.)Mygmrs.net (17 seconds ago.)41lstreet.com (17 seconds ago.)Journoterrorist.com (17 seconds ago.)Mbottechnologies.com (18 seconds ago.)Bibleheroes.art (18 seconds ago.)Euroreagent.com (18 seconds ago.)Souan-fukuoka.com (19 seconds ago.)Widfair.com (20 seconds ago.)Smith-homes.com (21 seconds ago.)Alyssaweddingphoto.com (21 seconds ago.)Matthewdavidwardllc.com (23 seconds ago.)Gimgroup.biz (23 seconds ago.)Kopiarki.info.pl (23 seconds ago.)Featuress.online (24 seconds ago.)Fglmodernconsults.com (24 seconds ago.)Kimhope.earth (24 seconds ago.)

Recently Searched Keywords

left sidebar (1 second ago.)logiciel (4 seconds ago.)enchres else (6 seconds ago.)transform translate0 -50 (7 seconds ago.)3 ưu điểm vượt trội của isilax bimbi khiến bạn phải mua ngay để giúp con hết táo bón (7 seconds ago.)villa sahaja (8 seconds ago.)twister флешки (8 seconds ago.)typu 2 (8 seconds ago.)lufthansa has applied special  (10 seconds ago.)bodyanimate (15 seconds ago.)xfinity email (16 seconds ago.)jones-blue (18 seconds ago.)-ms-linear-gradientbottom (21 seconds ago.)televisi (21 seconds ago.)afiliado (22 seconds ago.)xbridgesystems (25 seconds ago.)freeshipping (26 seconds ago.)normaltext-decoration (30 seconds ago.)help protecting (30 seconds ago.)activated carbon (34 seconds ago.)wchemnie odby si (36 seconds ago.)linear (37 seconds ago.)tool (38 seconds ago.)phone 255 (38 seconds ago.)xnxxspot (46 seconds ago.)wpsmprogress-pro-bar (50 seconds ago.)xf125gy-2b (53 seconds ago.)-moz-linear-gradientbottom (54 seconds ago.)$1 start certified, luxury & designer jewelry (54 seconds ago.)stop smoking (55 seconds ago.)