Reddoors.co.uk Favicon Reddoors.co.uk

Reddoors.co.uk Website Thumbnail
Checking...
Holiday Cottages Devon | Luxury Family Holidays | Red Doors Farm
Low trust score
Add a review Change category Claim this site
Luxury self catering family holiday cottages nestled in the Blackdown Hills. Facilities include an indoor heated swimming pool, games room and children's play areas


Domain summary

Domain label
reddoors
Domain extension
co.uk
Domain registered:
27-Sep-1999
Domain updated:
19-Aug-2020
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is reddoors.co.uk ranked relative to other sites:

Percentage of visits to reddoors.co.uk from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Reddoors.co.uk registered?
A: Reddoors.co.uk was registered 21 years, 3 weeks, 3 days, 4 hours, 54 minutes, 38 seconds ago on Monday, September 27, 1999.
Q: When was the WHOIS for Reddoors.co.uk last updated?
A: The WHOIS entry was last updated 2 months, 2 days, 4 hours, 54 minutes, 38 seconds ago on Wednesday, August 19, 2020.
Q: What are Reddoors.co.uk's nameservers?
A: DNS for Reddoors.co.uk is provided by the following nameservers:
  • cris.ns.cloudflare.com
  • priscilla.ns.cloudflare.com
Q: Who is the registrar for the Reddoors.co.uk domain?
A: The domain has been registered at Nominet UK.
Q: What is the traffic rank for Reddoors.co.uk?
A: Reddoors.co.uk has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Reddoors.co.uk each day?
A: Reddoors.co.uk receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Reddoors.co.uk resolve to?
A: Reddoors.co.uk resolves to the IPv4 address 104.28.25.241.
Q: In what country are Reddoors.co.uk servers located in?
A: Reddoors.co.uk has servers located in the United States.
Q: What webserver software does Reddoors.co.uk use?
A: Reddoors.co.uk is powered by CloudFlare webserver.
Q: Who hosts Reddoors.co.uk?
A: Reddoors.co.uk is hosted by TOT Public Company Limited in United States.
Q: How much is Reddoors.co.uk worth?
A: Reddoors.co.uk has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Reddoors.co.uk?

Reddoors.co.uk Hosting Provider Information

Hosted IP Address:104.28.25.241
Hosted Hostname:104.28.25.241
Service Provider:TOT Public Company Limited
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "TOT Public Company Limited" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Reddoors.co.uk

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Wed, 30 Sep 2020 00:25:16 GMT
Content-Type: text/html; charset=iso-8859-1
Transfer-Encoding: chunked
Connection: keep-alive
location: https://reddoors.co.uk/
cache-control: max-age=604800
expires: Wed, 07 Oct 2020 00:25:16 GMT
CF-Cache-Status: DYNAMIC
cf-request-id: 057dff40ca0000076265178200000001
Report-To: {"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report?lkg-colo=21&lkg-time=1601425517"}],"group":"cf-nel","max_age":604800}
NEL: {"report_to":"cf-nel","max_age":604800}
Server: cloudflare
CF-RAY: 5da9ce47aacc0762-LHR

Reddoors.co.uk Domain Nameserver Information

HostIP AddressCountry
cris.ns.cloudflare.com 162.159.44.202
priscilla.ns.cloudflare.com 162.159.38.189


Need to find out who hosts Reddoors.co.uk?


WhoIs information for Reddoors.co.uk

 Domain name:
reddoors.co.uk

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 02-Dec-2015

Registrar:
Pulse 8 Internet Ltd t/a Pulse8 Hosting [Tag = PULSE8INTERNET]
URL: http://www.pulse8hosting.co.uk

Relevant dates:
Registered on: 27-Sep-1999
Expiry date: 27-Sep-2021
Last updated: 19-Aug-2020

Registration status:
Registered until expiry date.

Name servers:
cris.ns.cloudflare.com
priscilla.ns.cloudflare.com

WHOIS lookup made at 15:48:22 01-Sep-2020

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2020.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at https://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Reddoors.co.uk Free SEO Report

Website Inpage Analysis for Reddoors.co.uk

H1 Headings

2 :
  1. 5 Star Gold Award Holiday Cottages in Devon, with indoor heated swimming pool & on-site facilities to keep the children entertained. 
  2. Perfect for Luxury Family Holidays

H2 Headings

3 :
  1. Devon Holiday Cottages
  2. A Perfect Holiday Location
  3. On-site Facilities and Equipment for Babies & Children

H3 Headings

0 :

H4 Headings

6 :
  1. The Farmhouse Sleeps 8 + cot
  2. Byre CottageSleeps 6 + cot
  3. Orchard CottageSleeps 6 + cot
  4. Cider BarnSleeps 5 + cot
  5. Holly CottageSleeps 2 + cot
  6. Swallows LoftSleeps 2 + cot

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

45 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-29009611-1

Links - Internal

23:
  1. Red Doors Farm
    http://reddoors.co.uk/
  2. [email protected]
    http://reddoors.co.uk/cdn-cgi/l/email-protection
  3. Home
    http://reddoors.co.uk/
  4. Blog
    http://reddoors.co.uk/blog
  5. Useful Information
    http://reddoors.co.uk/useful-information
  6. Services
    http://reddoors.co.uk/services
  7. Gallery
    http://reddoors.co.uk/gallery
  8. Contact
    http://reddoors.co.uk/contact
  9. Reviews
    http://reddoors.co.uk/reviews
  10. Special Offers
    http://reddoors.co.uk/special-offers
  11. The Farmhouse Sleeps 8 + cot
    http://reddoors.co.uk/cottage/the-farmhouse/2
  12. Byre CottageSleeps 6 + cot
    http://reddoors.co.uk/cottage/byre-cottage/4
  13. Orchard CottageSleeps 6 + cot
    http://reddoors.co.uk/cottage/orchard-cottage/1
  14. Cider BarnSleeps 5 + cot
    http://reddoors.co.uk/cottage/cider-barn/3
  15. Holly CottageSleeps 2 + cot
    http://reddoors.co.uk/cottage/holly-cottage/5
  16. Swallows LoftSleeps 2 + cot
    http://reddoors.co.uk/cottage/swallows-loft/6
  17. Availability & Book Online
    http://reddoors.co.uk/availability
  18. Facilities & Activities
    http://reddoors.co.uk/facilities
  19. View our facilities
    http://reddoors.co.uk/facilities
  20. Facilities
    http://reddoors.co.uk/facilities
  21. Terms & Conditions
    http://reddoors.co.uk/terms
  22. Access Statement
    http://reddoors.co.uk/access
  23. Privacy & Cookie Policy
    http://reddoors.co.uk/cookies

Links - Internal (nofollow)

0:

Links - Outbound

5:
  1. No text
    https://www.facebook.com/reddoorsfarm
  2. No text
    https://twitter.com/reddoorsfarm
  3. No text
    https://www.tripadvisor.co.uk/VacationRentalReview-g315954-d1918980-Red_Doors_Farm-Honiton_Devon_England.html
  4. No text
    https://www.premiercottages.co.uk/
  5. Devon Design & Development by Pulse8
    http://pulse8.co.uk

Links - Outbound (nofollow)

0:

Keyword Cloud for Reddoors.co.uk

red doors farm1devonviewsifallhighperfectfamilyfamily marampgoldvisitnovfirstneedstayfamily nov04special3familiesluxurylovely2family octoberstay at reddoorsmarwe havecotbeenfacilitiesbeautifulhomebutyoumar 18backoctober 17timefamily novembercottageswecottagesleepsnotweekholiday cottagesawayherenovemberareathank youfarmredourevenoctobernovember 17thankour firstfamily october 17family nov 17reallyfamily mar 18hollyholidaydoors farmprovidedefinitelynov 1717 oursuchhadchildrenfamily november 17equipmenthavecouldred doorsjustitscottagesobaby

Longtail Keyword Density for Reddoors.co.uk

KeywordsOccurences
red doors farm7
family november 174
stay at red4
family october 173
family nov 173
family mar 183
red doors16
doors farm7
holiday cottages4
october 174
family november4
november 174
our first4
we have3
family october3
thank you3
17 our3
family nov3
nov 173
family mar3
mar 183
family28
our23
red16
doors16
we14
013
holiday12
111
facilities11
perfect10
children10
you9
stay8
cottages8
farm8
amp7
so7
have6
lovely6
all6
visit6
cottage6
cot6
such5
devon5
first5
back5
been5
24
time4
thank4
november4
week4
october4
even4
could4
beautiful4
34
luxury4
provide4
families4
gold3
mar3
nov3
home3
had3
definitely3
special3
its3
area3
cottagesleeps3
need3
here3
43
holly3
not3
baby3
equipment3
high3
if3
away3
views3
but3
really3
just3

Reddoors.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Reddoors.co.uk is a scam?

Websites with Similar Names

Reddo-reddo.com
百度一下,你就知道
Reddocfarm.com
Red Doc Farm | The Brand You Trust!
Reddochmediagroup.com
Home-3 | RMG Web Marketing
Reddodgepodcast.com
LineupMedia.fm - Time Well Spent
Reddodo.com
Coming Soon - Future home of something quite cool
Reddoe.com
RedDoe.com is for sale
Reddoff.com
HugeDomains.com - Shop for over 300,000 Premium Domains
Reddog-erie.com
Company - Reddog Industries, Inc.

Recently Updated Websites

Womenandfamilynutrition.com 2 seconds ago.Natureandnurtureseeds.com 2 seconds ago.Gooohe.com 2 seconds ago.Rerickandsons.com 3 seconds ago.Ediliziasucorda.info 4 seconds ago.Escapia-vacances.com 4 seconds ago.Uzunoglumermer.com 4 seconds ago.Rencontres-femmes-russe.com 4 seconds ago.Green-cause.org 4 seconds ago.Fatherandsonbarbershop.com 4 seconds ago.B-area.com 5 seconds ago.Ba4ka.com 5 seconds ago.Mydemesne.com 5 seconds ago.Demandcontrolschema.com 5 seconds ago.Seodic.ru 5 seconds ago.Okuma.com 5 seconds ago.Csgocodes.net 6 seconds ago.Sochickidz.com 6 seconds ago.Orionstudentins.info 7 seconds ago.Healthinformationnetworkofarizona.com 7 seconds ago.Cnypa.net 7 seconds ago.Japanichi.com.ph 8 seconds ago.Dtt-group.com 8 seconds ago.Thinklli.com 8 seconds ago.Paulcookfilm.com 8 seconds ago.Rrobinpa.com 8 seconds ago.Austinamericanastudio.com 8 seconds ago.Vagarena.fi 8 seconds ago.Autotether.com 9 seconds ago.Camdensciencelabs.com 9 seconds ago.