Red Tentacle

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-11-26
Category: This site has not been categorized yet


Domain summary

Domain label
redtentacle
Domain extension
ca
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is redtentacle.ca ranked relative to other sites:

Percentage of visits to redtentacle.ca from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Redtentacle.ca registered?
A: Redtentacle.ca was registered 1 month, 3 weeks, 3 days, 5 hours, 44 minutes, 39 seconds ago on Thursday, November 26, 2020.
Q: When was the WHOIS for Redtentacle.ca last updated?
A: The WHOIS entry was last updated 1 month, 3 weeks, 3 days, 5 hours, 44 minutes, 39 seconds ago on Thursday, November 26, 2020.
Q: What are Redtentacle.ca's nameservers?
A: DNS for Redtentacle.ca is provided by the following nameservers:
  • ns01.domaincontrol.com
  • ns02.domaincontrol.com
Q: Who is the registrar for the Redtentacle.ca domain?
A: The domain has been registered at CIRA.
Q: What is the traffic rank for Redtentacle.ca?
A: Redtentacle.ca has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Redtentacle.ca each day?
A: Redtentacle.ca receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Redtentacle.ca resolve to?
A: Redtentacle.ca resolves to the IPv4 address 198.49.23.144.
Q: In what country are Redtentacle.ca servers located in?
A: Redtentacle.ca has servers located in the United States.
Q: What webserver software does Redtentacle.ca use?
A: Redtentacle.ca is powered by Squarespace webserver.
Q: Who hosts Redtentacle.ca?
A: Redtentacle.ca is hosted by Squarespace, Inc. in New York, New York, United States, 10013.
Q: How much is Redtentacle.ca worth?
A: Redtentacle.ca has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Redtentacle.ca Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Redtentacle.ca Free SEO Report

Website Inpage Analysis for Redtentacle.ca

H1 Headings

1 :
  1. Sleep w/ guests Pontiak

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

2 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Redtentacle.ca

dataslicetypesocialiconshover meetuphoversqsslidecontainerdataslidetypepopupoverlayenableoverlaycontentborderdataslicetypesocialicons vimeodataslicetypeheadingnotdatacompoundtypeeaseinouttransitionbackgroundcolor 170ms easeinoutsqsslidewrapperdataslidetypecoverpage2s 2sdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizesmallsocialiconsstylesoliddataslicetypesocialiconshover smugmughoveractionsnotstacked inputwrappernothiddengoogleplaydataslicetypesocialiconshover itunesdataslicetypesocialicons pinterestyoutubeusebackgroundfillfffsqsslidewrapperdataslidetypecoverpagescreenasqsslidewrapperdataslidetypecoverpage buttonstyleoutlinedataslicetypealbumhover iconwrapperimportantsqsslidewrapperdataslidetypecoverpage sqsslidecontainernotautoimagebackgroundcolorsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled dataslicetypebodyvscohoveraudioplayericonsstylesoliddataslicetypealbumlockstylesolid dataslicetypelockuseiconfillfffbackgroundcolorfffsqsslidewrapperdataslidetypecoverpagecountdowncontentdataformatnumericulsqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons stitchertweetdisplaynamedataslicetypesocialicons rdiodataslicetypesocialiconshover emaildataslicetypealbum tracktitleuseiconfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregularsocialiconsstylesolid dataslicetypesocialiconshover iconwrapperdataslicetypesocialiconshover pinterest2s easeinmoztransitionopacityusemaskfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshoverfielderrordisplayblockpositionabsoluteboxsizingborderboxpadding25emformitemsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinedataslicetypesocialiconshover tidalcountdowncontentdataformattextual countdownunitbuttonstylesoliduseiconfill1ab7easqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinline dataslicetypebuttonssocialiconscolorstandardsocialiconsstyleknockoutdataslicetypegallery galleryvideobackgroundsolidfoursquare0sqsmodallightboxcontent lightboxinner2em 0px 0pxbandsintownall and maxwidth1020pxiconwrapperwidth32pxheight32pxmargin0audioplayericonsstyleregular dataslicetypealbumrsssvgsocialwebkittransitionbackgroundcolorsocialiconssizeextrasmallsocialiconsstyleregulardataslicetypesocialiconshover vevosqsslidecontainerdataslidetypepopupoverlaytidalsocialstackedtextalignleft dataslicetypesocialiconsactionsstacked inputwrappernothidden7px170ms easeinoutsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover mediumhoverdataslicetypesocialiconshover youtubehoveraudioplayericonsstyleborder dataslicetypealbumsqsslicecustomform asqsslidewrapperdataslidetypecoverpageaudioplayericonsstylesolid dataslicetypealbumhoverdatacompoundtypepopupoverlayaction inputtypetextsqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline dataslicetypebuttons libuttonplaypausedataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpageuseiconfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleborderdataslicetypealbum iconwrapperlastchildmarginright0sqsslidewrapperdataslidetypecoverpagedataslicetypealbum sqsslicealbumplaylist tracksvimeodatacompoundtypepopupoverlayaction errormessagesqsslidewrapperdataslidetypecoverpagemediumhovereaseinout bordercolor 170msdataslicetypelock usebackgroundfilltransparentsqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextrasmallsocialiconsstyleknockoutdataslicetypesocialiconshover iconwrapperhoversqsslidewrapperdataslidetypecoverpageeaseinmoztransitionopacity 2ssnapchathoverdataslicetypebodysqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover dropboxhoverredditdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizelargesocialiconsstyleknockoutsocialiconsstyleregular dataslicetypesocialiconseaseinoutmoztransitionbackgroundcolor 170ms easeinoutmstransitionbackgroundcolorsqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlineauto dataslicetypebuttonsdataslicetypesocialiconshover reddithoversocialiconssizemediumsocialiconsstylesoliditunesdisplaytablesqsslidewrapperdataslidetypecoverpageuseiconfill006ed2sqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons yelpsqsslidewrapperdataslidetypecoverpage dataslicetypecountdown countdowncontentdataformatnumericbuttonsqsslidewrapperdataslidetypecoverpagesocialiconssizeextralargesocialiconsstyleborderdataslicetypesocialicons redditsqsmodallightboxsocialiconsstyleknockoutdataslicetypebuttons ul lisqsslidewrapperdataslidetypecoverpagesqsalbumminimal dataslicetypealbum sqsslicealbumplaylistdemoalbumeaseinoutotransitionbackgroundcolor 170ms easeinouttransitionbackgroundcoloronly screendataslicetypetwitternotdatacompoundtype tweettimestampsocialiconsstyleborder dataslicetypesocialiconsbuttonstyleoutlinesqsmodallightbox formwrapper inputtypesubmitsqsslidewrapperdataslidetypecoverpage2sdataslicetypesocialicons youtubesqsmodallightboxcontent lightboxinner lightboxcontentdataslicetypesocialiconshover bandsintownhoversqsslidecontainernotautoimagebackgroundcolordataslicetypetwitternotdatacompoundtypevideoiconstylesoliddataslicetypesocialiconshover githubhovereaseinoutotransitioncolorusemaskfilltransparentsqsslidewrapperdataslidetypecoverpageli ahoversqsslidewrapperdataslidetypecoverpagepasswordstylerectangle dataslicetypepasswordsqsslicealbumplaylistplayingapplepodcasthoverdribbblehoversocialiconscolorstandardsocialiconsstylesolidreddithovervideoiconstyleknockoutdataslicetypesocialiconshover facebookhoversvgsocialwebkittransitionbackgroundcolor 170ms easeinoutmoztransitionbackgroundcolorresponsivewrapperstackeddataslicetypesocialicons bandsintowntidalhover170mssqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlineiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextralargesocialiconsstylesoliddataslicetypesocialiconshover flickrhoveruseiconfillff4500sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover stumbleuponhoversocialiconssizeextralargesocialiconsstyleregularuseiconfill8c8070sqsslidewrapperdataslidetypecoverpagehouzzsqsslidewrapperdataslidetypecoverpage responsivewrappernotstackeddataslicetypetwitternotdatacompoundtype tweetbodyuseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconsall and maxwidth600pxsqsslidewrapperdataslidetypecoverpage2s easesqsslidewrapperdataslidetypecoverpageuseiconfill00b4b3sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconsformwrapper inputtypesubmitsqsslidewrapperdataslidetypecoverpagedataslicetypecountdown countdowncontentdataformattextualdataslicetypesocialiconshover stitcherdataslicetypesocialiconshover yelpsqsslidecontainerdataslidetypepopupoverlayoverlayloadanimationslideinemail6pxuseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesoliduseiconfille4405fsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover snapchatdataslicetypepassword inputtypepasswordsqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizelargesocialiconsstylesoliddataslicetypesocialiconshover fivehundredpixhoversqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstackedbuttonstyleoutline sqsslicecustomformaudioplayericonsstyleregulardataslicetypesocialicons behancesvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconsuseiconfill4183c4sqsslidewrapperdataslidetypecoverpagesvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesoliddataslicetypesocialiconshover youtubedataslicetypesocialicons soundclouddataslicetypebuttons ulstackedsocialiconssizemediumsocialiconsstyleknockoutdataslicetypesocialiconshover googleplayiconwrapperlastchildsqsslidewrapperdataslidetypecoverpageeaseinoutotransitionbackgroundcoloruseiconfill1ea9e1sqsslidewrapperdataslidetypecoverpageeaseinoutmoztransitionbackgroundcolorgoogletweettimestampdataslicetypesocialiconshover applepodcastinstagramuseiconfill3b5998sqsslidewrapperdataslidetypecoverpagegmstyleccresponsivewrapperstacked dataslicetypebuttonsresponsivewrappermeetupcaptchacontainerwrappereaseinout170ms easeinout bordercolordataslicetypesocialicons snapchatdataslicetypealbum sqsslicealbumplayliststackedthedotshovervscosvgsocialbackgroundcolortransparentsqsslidewrapperdataslidetypecoverpageformwrapper inputtypesubmitsqsslidewrapperdataslidetypecoverpage buttonstyleoutlinedataslicetypebody p170ms easeinouttransitionbackgroundcolor 170msaudioplayericonsstyleborderul li asqsslidewrapperdataslidetypecoverpage5emfont14pxasqsslidewrapperdataslidetypecoverpage buttonstyleoutline sqsslicecustomformdataslicetypesocialiconshover vevohoverdataslicetypesocialiconshover goodreadsgooglehovertracktitleallavisitedsqsslidewrapperdataslidetypecoverpage2emtweetavatariconwrapperwidth28pxheight28pxmargin0datacompoundtypelogoinputwrappernothiddenuseiconfill0063dcsqsslidewrapperdataslidetypecoverpagesoundcloudhovertracksvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpageeasesqsslidewrapperdataslidetypecoverpageuseiconfill1769ffsqsslidewrapperdataslidetypecoverpageuseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockoutbuttonstyleoutlineuseiconfill222sqsslidewrapperdataslidetypecoverpagedataslicetypealbum iconwrappersqsslidewrapperdataslidetypecoverpagedataslicetypemap gmnoprintdataslicetypesocialiconshover spotifyuseiconfillrgba2552552554sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolidul lisocialiconssizelargesocialiconsstylesolidfivehundredpixbordercolor 170ms2s easeinotransitionopacitydataslicetypesocialiconshover ituneshovertweetbodysqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsnotstacked inputwrappernothiddenuseiconfill55aceesqsslidewrapperdataslidetypecoverpagelightboxcontent formwrappertracks trackspotifyhoverdataslicetypesocialicons goodreadsonly2em 0pxiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextrasmallsocialiconsstylesolidsocialstacked dataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons meetupdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextralargesocialiconsstylesolid2s easeinmstransitionopacity170ms easeoutopacity 170msdataslicetypesocialiconshover github0sqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstacked inputwrapperusemaskfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesoliddataslicetypealbum sqsslicealbumplaylistdemoalbumulstackedsocialstackedtextalignleftsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleraiseduseiconfilldc4e41sqsslidewrapperdataslidetypecoverpagebuttontypesubmitsqsslidewrapperdataslidetypecoverpagerdiohoverbehancehoverresponsivewrappernotstackeddataslicetypesocialiconshover squarespacehoversocialiconsstylesolid dataslicetypesocialiconshoverul lisqsslidewrapperdataslidetypecoverpageuseiconfill6441a5sqsslidewrapperdataslidetypecoverpagedataslicetypebuttons li asqsslidewrapperdataslidetypecoverpagesocialiconssizesmallsocialiconsstylesolidbordercolor 170ms easeinoutsqsslidewrapperdataslidetypecoverpagedataslicetypegallerysqsgallerygrideaseinoutmstransitionbackgroundcolor 170msuseiconfill7dbb00sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover twittertwitterhover4pxsqsslicecustomform spansqsslidewrapperdataslidetypecoverpageuseiconfille0393esqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstacked inputwrappernothiddensqsslicedatacontentemptytruedisplaynonesqsslidewrapperdataslidetypecoverpagevinehoverdataslicetypesocialiconshover dribbblehoverdataslicetypesocialiconshover iconwrapperbehancesqsslicealbumplaylist tracks trackeaseinoutsqsslidewrapperdataslidetypecoverpagemaxwidth600pxsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover googlehoverdataslicetypesocialiconshover soundclouddataslicetypesocialicons dribbbledataslicetypesocialiconshover stitcherhoveruseiconfille52d27sqsslidewrapperdataslidetypecoverpageuseiconfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshoverlightboxinner lightboxcontent formwrappersvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoversocialiconsstylesolideaseinotransitionopacitysqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleauto dataslicetypebuttonscodependataslicetypesocialiconshover flickrdataslicetypesocialiconshover vscocountdownunitdataslicetypesocialicons squarespace0px 0pxdataslicetypealbum iconwrapperlastchildsqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons fivehundredpixlockstyleborderdataslicetypegallerygmnoprintsocialiconscolorstandardsocialiconsstyleregularuseiconfillf60sqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenableddataslicetypesocialiconshover pinteresthoverdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizemediumsocialiconsstylesoliddataslicetypesocialiconshover vinehovericonwrapperwidth24pxheight24pxmargin0dataslicetypesocialiconshover foursquarehovervevohoversocialiconsstylesolid dataslicetypesocialiconshover iconwrapperhoverdataslicetypepasswordtrackprogressbardatacompoundtypepopupoverlayactionstitcherdataslicetypesocialicons twitterdataslicetypesocialiconshover rssuseiconfille6b91esqsslidewrapperdataslidetypecoverpage170ms easeinoutmoztransitionbackgroundcolor 170mssqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline dataslicetypebuttonsdataslicetypesocialiconshover vinesocialstackedtextalignleft dataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpagerdiodataslicetypebuttons ul14px170ms easeinoutmstransitionbackgroundcolorformwrapperdataslicetypesocialicons mediumresponsivewrapperstacked sqsslicecustomformuseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoverdataslicetypebuttons li ahoversqsslidewrapperdataslidetypecoverpageinputtypesubmitsqsslidewrapperdataslidetypecoverpageeaseoutopacity 170msdataslicetypesocialicons dropboxscreen and maxwidth600pxsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover spotifyhoverinputtypepasswordsqsslidewrapperdataslidetypecoverpageiconwrapperdivwebkittransformscale2moztransformscale2mstransformscale2transformscale2sqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizesmallsocialiconsstyleknockoutlightboxinnersqsslidecontainerdataslidetypepopupoverlaynewsletterstyleoutline10pxdataslicetypebuttons ahoversqsslidewrapperdataslidetypecoverpage01ssqsslidesqsslideanimationreadyenablepagebordersqsslidecontainerbuttonsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstackeduseiconfill35465dsqsslidewrapperdataslidetypecoverpage1dataslicetypebuttons lisqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover thedotsuseiconfill000sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover meetupeaseintransitionopacity 2ssqsslidecontainerdataslidetypepopupoverlaynewsletterstyleunderlined datacompoundtypepopupoverlayactioniconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizesmallsocialiconsstylesolidsqsmodallightboxcontentsocialiconsstyleregulareaseoutopacitysocialiconscolorstandardsocialiconsstyleborder dataslicetypesocialiconsdataslicetypealbumhover iconwrapperhoversocialiconssizelargesocialiconsstylebordermaxwidth1020pxstumbleuponhoversocialstacked dataslicetypesocialiconssocialiconssizesmallsocialiconsstyleregularthedotsapplepodcastactionssqsslidewrapperdataslidetypecoverpageuseiconfillrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshoverresponsivewrapperstacked dataslicetypebuttons ulsqsslidewrapperdataslidetypecoverpagestumbleuponuseiconfill7ac143sqsslidewrapperdataslidetypecoverpagedataslicetypecountdown countdowncontentdataformatnumerictwitchtumblrhoversqsslicealbumplaylistdemoalbumsocialiconssizeextrasmallsocialiconsstyleborderuseiconfill0976b4sqsslidewrapperdataslidetypecoverpageeaseinmstransitionopacity170ms easeinoutotransitionbackgroundcolormaxwidth1020pxsqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons rssdataslicetypesocialiconshover instagramhoveractionsstacked inputwrapperdataslicetypesocialicons stumbleuponimdbdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextrasmallsocialiconsstylesolidsquarespacehovervideoiconstyleregulardataslicetypesocialiconshover stumbleupon100msautoflex1useiconfillec4652sqsslidewrapperdataslidetypecoverpageautosqsslidewrapperdataslidetypecoverpagevimeohoversqsslidelayercontenttwitterdropboxiconwrapperhovergithubsqsslidecontainerdataslidetypepopupoverlaynewsletterstylerectangledataslicetypealbum sqsslicealbumplaylistplayingdataslicetypesocialicons usemaskfilltransparentsqsslidewrapperdataslidetypecoverpagelockstylesolid170ms easeoutopacityiconwrapperborder2pxinputtypepasswordmozplaceholdercolorfffsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover smugmugsqsalbumminimal dataslicetypealbum sqsslicealbumplaylistimportantsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinedataslicetypesocialiconshover tumblrhoverdataslicetypenavigation uldataslicetypebuttons asqsslidewrapperdataslidetypecoverpagedataslicetypecountdown countdowncontentdataformattextual countdownunitflickruseiconfill382110sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover goodreadshoverlockstyleknockoutsocialiconssizemediumsocialiconsstyleborderlightboxcontentdataslicetypesocialiconshover linkedinhoverpasswordstyleunderlined dataslicetypepasswordeaseinouttransitionbackgroundcolor 170msbuttonstyleoutline datacompoundtypepopupoverlayactionvevodataslicetypebuttons ulsqsslidewrapperdataslidetypecoverpageiconwrappereaseinoutotransitionbackgroundcolor 170mseaseinoutmstransitionbackgroundcolorsqsslidecontainerdataslidetypepopupoverlaynewsletterstyleunderlined5pxsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled dataslicetypebody puseiconfill5adfcbsqsslidewrapperdataslidetypecoverpagebuttonstyleoutlinesqsmodallightbox formwrappersocialiconssizelargesocialiconsstyleregulardataslicetypegallery galleryvideobackgroundmobileiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizelargesocialiconsstylesolidsqsslicealbumplaylistmeetuphoverp asqsslidewrapperdataslidetypecoverpagelockstyleknockout dataslicetypelocksqsalbumminimal dataslicetypealbum sqsslicealbumplayliststackedinputtypesubmitsqsslidewrapperdataslidetypecoverpage buttonstyleoutline datacompoundtypepopupoverlayactiondatacompoundtypepopupoverlayaction inputtypetextmozplaceholdercolorrgba1631631635sqsslidewrapperdataslidetypecoverpagesocialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshoveruseiconfillrgba2552552554sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoveruseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconsdatacompoundtypepopupoverlayaction buttontypesubmitsqsslidewrapperdataslidetypecoverpagersshoverimdbhoversqsslidelayersplitfiftyspotifydataslicetypesocialiconshover imdbsocialiconssizeextralargesocialiconsstyleknockoutsocialiconssizeextrasmallsocialiconsstyleknockoutsvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolideaseinoutmstransitionbackgroundcolor 170ms easeinoutotransitionbackgroundcolorgoodreadssmugmughoverdataslicetypesocialicons imdbadisplayblocksqsslidewrapperdataslidetypecoverpageuseiconfill00b488sqsslidewrapperdataslidetypecoverpagepinteresthoverdataslicetypetwitter tweetavatardataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizemediumsocialiconsstyleknockoutdataslicetypesocialicons googleplaytweethandledataslicetypesocialiconshover instagramyelpvideoiconstyleborderalignmentcenter responsivewrapperstackedtracksyoutubehoverfivehundredpixhover1pxiconwrappersqsslidewrapperdataslidetypecoverpageuseiconfill444sqsslidewrapperdataslidetypecoverpagedataslicetypealbum iconwrapperuseiconfillae995asqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons githubdataslicetypesocialicons vevoahoversqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons vinedataslicetypebuttonsdataslicetypesocialiconshover vimeohover170ms easeinoutmoztransitionbackgroundcolorlockstyleborder dataslicetypelockusemaskfillrgba3434344sqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons houzzuseiconfillff0031sqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlaynewsletterstylerectangle datacompoundtypepopupoverlayactionpinterestsqsslicecustomform ahoversqsslidewrapperdataslidetypecoverpagesvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypecoverpageyelphoverdataslicetypesocialicons smugmugdataslicetypesocialiconshover medium170ms easeinoutmstransitionbackgroundcolor 170msdataslicetypesocialiconshover redditformwrapper pdataslicetypesocialiconshover linkedindataslicetypesocialiconshover codepen0 0sqsslidewrapperdataslidetypecoverpageuseiconfillcc2127sqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons codepenaudioplayericonsstyleknockoutdataslicetypesocialiconshover squarespacedataslicetypesocialiconshover houzzsqsslidecontainerdataslidetypepopupoverlay datacompoundtypepopupoverlayactionli asqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover rdionovhbuttonstyleoutline dataslicetypebuttonsgalleryvideobackgrounddataslicetypesocialicons flickrusemaskfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconsneuearialsansseriffontweightnormalfontstylenormalletterspacing6pxsqsslidewrapperdataslidetypecoverpageinputtypetextsqsslidewrapperdataslidetypecoverpagesqsslidewrapperdataslidetypecoverpage dataslicetypebuttonseaseinmoztransitionopacitybordercoloreaseinoutmoztransitioncolordataslicetypenavigationusemaskfillrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockoutbandsintownhoverspansqsslidewrapperdataslidetypecoverpagesocialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshoversocialiconssizelargesocialiconsstyleknockoutcountdowncontentdataformattextualituneshovereaseinotransitionopacity 2sdataslicetypecountdowndataslicetypesocialicons thedotssqssliceplaybuttoniconwrapperhovericonwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextrasmallsocialiconsstyleknockoutsocialiconssizesmallsocialiconsstyleknockoutuseiconfill84bd00sqsslidewrapperdataslidetypecoverpageinstagramhoverfacebookhovereaseinouttransitionbackgroundcolorlockstyleregularlightboxcontent formwrapper puseiconfillea4c89sqsslidewrapperdataslidetypecoverpagesocialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconssqsslicecustomformdropboxhoverstitcherhoversocialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconssqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlineautofielderrordisplayblockpositionabsoluteboxsizingborderboxpadding25em 5emfont14pxdataslicetypesocialiconshover behancemediumactionsstackedsqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsnotstackeduseiconfillfffsqsslidewrapperdataslidetypecoverpagesocialiconsstyleknockout dataslicetypesocialiconsdataslicetypesocialiconshover googleplayhoveruseiconfillrgba2552552554sqsslidewrapperdataslidetypecoverpageflickrhoversqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstylestackedsqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstylestacked inputwrapperdataslicetypesocialiconshover twitterhoverdataslicetypebuttons ul lisqssliceplaybuttoniconwrappersqsslidewrapperdataslidetypecoverpage170ms easeinoutotransitionbackgroundcolor 170msdataslicetypebuttons lisqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlinesqssliceplaybuttoniconwrapperdataslicetypesocialiconshover twitchhoverusemaskfillrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshoverdataslicetypesocialiconshover tidalhovericonwrappersqsslidewrapperdataslidetypecoverpage socialiconssizemediumsocialiconsstyleknockoutresponsivewrapperstacked dataslicetypenavigation ulsocialiconsstylesolid dataslicetypesocialicons2s easeinmstransitionopacity 2sdataslicetypesocialicons emaildataslicetypelockdataslicetypesocialicons linkedinsocialiconssizeextralargesocialiconsstylesoliddataslicetypetwitterdataslicetypesocialiconshover behancehoverdataslicetypesocialiconshover thedotshoversqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline datacompoundtypepopupoverlayactionsvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshovericonwrapperwidth36pxheight36pxmargin0buttonshapepillsocialiconssizesmallsocialiconsstylebordereaseinouttransitioncolordataslicetypesocialiconshover dropboxsmugmugdataslicetypesocialiconshover soundcloudhoverdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextralargesocialiconsstyleknockoutsocialstacked170ms easeinouttransitionbackgroundcolorsqsslidecontainerdataslidetypepopupoverlayoverlayalignmentcenteruseiconfill0099e5sqsslidewrapperdataslidetypecoverpagesvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregularresponsivewrapperstackedtextaligncenteruldataslicetypealbum sqsslicealbumplaylistdataslicetypesocialiconshover yelphoverall and maxwidth1020pxsqsslidewrapperdataslidetypecoverpagedataslicetypepassword inputtypepasswordmozplaceholdercolorfffsqsslidewrapperdataslidetypecoverpagealignmentright responsivewrapperstackeddataslicetypesocialicons instagramdataslicetypesocialiconshover vimeoshowtracktitle sqsalbumminimal dataslicetypealbumasqsslidewrapperdataslidetypecoverpage dataslicetypetwittereaseinoutmoztransitionbackgroundcolor 170msshowtracktitledataslicetypesocialicons twitchdataslicetypebodyuseiconfillc41200sqsslidewrapperdataslidetypecoverpagedataslicetypemap gmstyleccgoodreadshoveruseiconfillf94877sqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons svgsocialbackgroundcolortransparentsqsslidewrapperdataslidetypecoverpage60pxshowtracktitle sqsalbumminimalsqsslicealbumplaylist tracksdataslicetypesocialiconshover dribbbledataslicetypesocialiconshover vscohoversqsslidecontainerdataslidetypepopupoverlaybuttonstyleoutlinebuttonshaperoundedcornersppasswordstyleunderlinedsqsslicecustomformsqsslidewrapperdataslidetypecoverpageiconwrapperlastchildmarginright0sqsslidewrapperdataslidetypecoverpage2s easeinotransitionopacity 2sfacebookemailhoversqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutlineuseiconfill00ab6csqsslidewrapperdataslidetypecoverpage8pxalignmentcenter2s easeintransitionopacity 2slightboxinner lightboxcontentalignmentrightuseiconfillrgba3434344sqsslidewrapperdataslidetypecoverpageeaseintransitionopacitysoundcloudformitemsqsslidewrapperdataslidetypecoverpagesqsalbumminimalvinedataslicetypesocialicons googleactionsnotstackedhouzzhoverlinkedinhoversqsmodallightboxopendataslicetypesocialicons itunessqsslidecontainerdataslidetypepopupoverlayoverlayalignmentleftuseiconfilleb4924sqsslidewrapperdataslidetypecoverpagesocialiconssizeextrasmallsocialiconsstylesolidsvgsocialwebkittransitionbackgroundcolor 170mseaseinoutmstransitioncolordataslicetypesocialiconshover foursquaredataslicetypesocialiconshover tumblr0mssocialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialicons2s easeintransitionopacitydataslicetypesocialiconshover imdbhovericonwrappersqsslidewrapperdataslidetypecoverpage socialiconssizemediumsocialiconsstylesolidinputtypesubmitsqsslidewrapperdataslidetypecoverpage buttonstyleoutlinedataslicetypesocialiconshover houzzhoverpasswordstylerectanglelisqsslidewrapperdataslidetypecoverpageimportantsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshoverdataslicetypesocialicons foursquaredataslicetypemaptumblrsocialiconscolorstandardsocialiconsstyleborderdribbbledataslicetypesocialicons applepodcastdataslicetypesocialicons vscolockstyleregular dataslicetypelockusemaskfill222sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover bandsintowngithubhovermapstyleminimaldarkusemaskfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockoutdisclaimercontainersqsslidewrapperdataslidetypecoverpageinputtypesubmithoversqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover snapchathoverdataslicetypesocialicons tumblrp ahoversqsslidewrapperdataslidetypecoverpagebuttonsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinedataslicetypenavigation ul lisocialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshovericonwrappersqsslidewrapperdataslidetypecoverpage socialiconssizelargesocialiconsstyleknockoutsnapchatdataslicetypebuttonssqsslidewrapperdataslidetypecoverpagegalleryvideobackgroundmobiledataslicetypesocialiconshover emailhoveruseiconfilltransparentsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover rdiohoverusebackgroundfilltransparentsqsslidewrapperdataslidetypecoverpageasqsslidewrapperdataslidetypecoverpagesqsslicealbumplayliststackeduseiconfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleborder dataslicetypesocialiconsdataslicetypesocialicons tidalresponsivewrapperstacked dataslicetypebuttons uleaseinout bordercolordataslicetypesocialicons facebookuseiconfillrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregulareaseinmstransitionopacity 2sarrowicondataslicetypesocialicons spotifysocialiconssizemediumsocialiconsstyleregulardataslicetypesocialiconshover googlelinkedinsocialiconsstyleborder3pxinputtypetextmozplaceholdercolorrgba1631631635sqsslidewrapperdataslidetypecoverpageinputwrapperbuttonstyleraisedsqsslidewrapperdataslidetypecoverpage dataslicetypecountdownresponsivewrapperstacked dataslicetypenavigationcodepenhoverdataslicetypepassword arrowicon2s easeinmoztransitionopacity 2sdataslicetypesocialiconshover rsshovericonwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextralargesocialiconsstyleknockoutlidataslicetypealbum trackprogressbarformwrapper inputtypesubmithoversqsslidewrapperdataslidetypecoverpagesqsalbumminimal dataslicetypealbumiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizesmallsocialiconsstyleknockouterrormessagesqsslidewrapperdataslidetypecoverpagesquarespacedataslicetypesocialiconshover facebookuseiconfill007ee5sqsslidewrapperdataslidetypecoverpagegoogleplayhover1seaseinoutsqsslidewrapperdataslidetypecoverpage socialiconsstylesolid0pxinputtypetextsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinesqsslidecontainerdataslidetypepopupoverlay captchacontainerwrappersqsslidecontainerdataslidetypepopupoverlaynewsletterstyleoutline datacompoundtypepopupoverlayactiondataslicetypealbumhoverdataslicetypesocialiconshover fivehundredpix170ms easeinoutdataslicetypesocialiconshover twitchdataslicetypesocialiconshover codepenhover0ms 0mssqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleautofoursquarehoverbuttonstyleoutlinesqsmodallightboxsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled datacompoundtypepopupoverlayactiontwitchhoverdataslicetypesocialiconshover applepodcasthover

Longtail Keyword Density for Redtentacle.ca

KeywordsOccurences
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-icons44
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover44
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons44
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover44
sqs-modal-lightbox-content lightbox-inner lightbox-content19
170ms ease-in-out border-color15
ease-in-out border-color 170ms15
sqs-album-minimal data-slice-typealbum sqs-slice-album-playlist14
lightbox-inner lightbox-content form-wrapper14
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-border data-slice-typesocial-icons12
data-slice-typealbum sqs-slice-album-playlist tracks11
socialstackedtext-align-left data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page10
socialstacked data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page10
170ms ease-in-out-ms-transitionbackground-color 170ms8
170ms ease-in-out-o-transitionbackground-color 170ms8
170ms ease-in-outtransitionbackground-color 170ms8
170ms ease-in-out-moz-transitionbackground-color 170ms8
sqs-slice-album-playlist tracks track7
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-icons6
2em 0px 0px6
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover6
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover6
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover6
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover6
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover6
show-track-title sqs-album-minimal data-slice-typealbum6
data-slice-typebuttons ul lisqs-slide-wrapperdata-slide-typecover-page6
ease-in-outtransitionbackground-color 170ms ease-in-outsqs-slide-wrapperdata-slide-typecover-page6
ease-in-out-o-transitionbackground-color 170ms ease-in-outtransitionbackground-color6
responsive-wrapperstacked data-slice-typenavigation ul6
ease-in-out-ms-transitionbackground-color 170ms ease-in-out-o-transitionbackground-color6
ease-in-out-moz-transitionbackground-color 170ms ease-in-out-ms-transitionbackground-color6
data-slice-typebuttons li asqs-slide-wrapperdata-slide-typecover-page5
data-slice-typenavigation ul li5
responsive-wrapperstacked data-slice-typebuttons ul5
170ms ease-outopacity 170ms5
all and max-width1020px4
social-icons-style-solid data-slice-typesocial-iconshover icon-wrapperhover4
data-slice-typebuttons ul li4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-slice-typebuttons li4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-slice-typebody p4
svgsocial-webkit-transitionbackground-color 170ms ease-in-out-moz-transitionbackground-color4
lightbox-content form-wrapper p4
all and max-width600pxsqs-slide-wrapperdata-slide-typecover-page4
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsnotstacked input-wrappernothidden4
all and max-width1020pxsqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked input-wrapper3
buttonsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked3
sqs-slide-wrapperdata-slide-typecover-page data-slice-typecountdown countdown-contentdata-formatnumeric3
data-slice-typecountdown countdown-contentdata-formattextual countdown-unit3
data-slice-typebuttons li ahoversqs-slide-wrapperdata-slide-typecover-page3
button-style-outlinesqs-modal-lightbox form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked input-wrappernothidden3
form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page button-style-outline3
inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page button-style-outline data-compound-typepopup-overlay-action3
social-icons-style-solid data-slice-typesocial-iconshover icon-wrapper3
responsive-wrapperstacked data-slice-typebuttons ulsqs-slide-wrapperdata-slide-typecover-page3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-largesocial-icons-style-solid3
sqs-album-minimal data-slice-typealbum sqs-slice-album-playliststacked3
ul li asqs-slide-wrapperdata-slide-typecover-page3
2s ease-in-moz-transitionopacity 2s3
2s ease-in-ms-transitionopacity 2s3
2s ease-in-o-transitionopacity 2s3
2s ease-intransitionopacity 2s3
border-color 170ms ease-in-outsqs-slide-wrapperdata-slide-typecover-page3
sqs-album-minimal data-slice-typealbum sqs-slice-album-playlistdemo-album3
screen and max-width600pxsqs-slide-wrapperdata-slide-typecover-page3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-largesocial-icons-style-knockout3
asqs-slide-wrapperdata-slide-typecover-page button-style-outline sqs-slice-custom-form3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-smallsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-smallsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-smallsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-mediumsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-mediumsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-largesocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-largesocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-smallsocial-icons-style-knockout3
social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover176
social-icons-color-standardsocial-icons-style-border data-slice-typesocial-icons176
social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover88
social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover88
social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons88
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid88
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout44
social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-icons44
social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-icons44
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid44
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page34
sqs-album-minimal data-slice-typealbum25
sqs-modal-lightbox-content lightbox-inner21
socialstackedtext-align-left data-slice-typesocial-icons20
socialstacked data-slice-typesocial-icons20
lightbox-inner lightbox-content19
data-slice-typecountdown countdown-contentdata-formatnumeric18
border-color 170ms15
data-slice-typealbum sqs-slice-album-playlist15
170ms ease-in-out15
ease-in-out border-color15
lightbox-content form-wrapper14
data-slice-typegallery gallery-video-background14
data-slice-typebuttons ul14
170ms ease-in-outsqs-slide-wrapperdata-slide-typecover-page13
data-slice-typenavigation ul12
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-border12
sqs-slide-containerdata-slide-typepopup-overlay data-compound-typepopup-overlay-action12
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsnotstacked12
sqs-slice-album-playlist tracks11
data-slice-typecountdown countdown-contentdata-formattextual11
0 0sqs-slide-wrapperdata-slide-typecover-page11
data-slice-typealbum icon-wrapper11
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked11
data-slice-typebuttons li10
data-slice-typealbum icon-wrapperlast-childmargin-right0sqs-slide-wrapperdata-slide-typecover-page10
data-slice-typealbum icon-wrappersqs-slide-wrapperdata-slide-typecover-page10
data-slice-typealbum icon-wrapperlast-childsqs-slide-wrapperdata-slide-typecover-page10
password-style-underlined data-slice-typepassword10
responsive-wrapperstacked data-slice-typebuttons9
ul li9
li asqs-slide-wrapperdata-slide-typecover-page9
responsive-wrapperstacked data-slice-typenavigation9
password-style-rectangle data-slice-typepassword9
170ms ease-in-outtransitionbackground-color8
data-slice-typebody p8
data-slice-typebuttons ulsqs-slide-wrapperdata-slide-typecover-page8
170ms ease-in-out-moz-transitionbackground-color8
ease-in-outtransitionbackground-color 170ms8
ease-in-out-moz-transitionbackground-color 170ms8
170ms ease-in-out-ms-transitionbackground-color8
data-slice-typebuttons asqs-slide-wrapperdata-slide-typecover-page8
ease-in-out-ms-transitionbackground-color 170ms8
170ms ease-in-out-o-transitionbackground-color8
ease-in-out-o-transitionbackground-color 170ms8
social-icons-style-solid data-slice-typesocial-iconshover8
ul lisqs-slide-wrapperdata-slide-typecover-page7
social-icons-style-border data-slice-typesocial-icons7
button-style-outlinesqs-modal-lightbox form-wrapper7
button-style-outline data-compound-typepopup-overlay-action7
show-track-title sqs-album-minimal7
sqs-slice-custom-form asqs-slide-wrapperdata-slide-typecover-page7
tracks track7
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout6
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-compound-typepopup-overlay-action6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-outline data-compound-typepopup-overlay-action6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-rectangle data-compound-typepopup-overlay-action6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular6
0px 0px6
audio-player-icons-style-border data-slice-typealbum6
data-slice-typealbum track-progress-bar6
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout6
form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page6
2em 0px6
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid6
button-style-outline sqs-slice-custom-form6
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid6
data-slice-typesocial-iconshover icon-wrapperhover6
button-style-outline data-slice-typebuttons6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid6
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular6
data-slice-typesocial-icons itunes5
data-slice-typesocial-icons linkedin5
data-slice-typesocial-icons medium5
data-slice-typesocial-icons meetup5
data-slice-typesocial-icons imdb5
data-slice-typesocial-icons instagram5
data-slice-typesocial-icons goodreads5
data-slice-typesocial-icons google5
data-slice-typesocial-icons googleplay5
data-slice-typesocial-icons github5
data-slice-typesocial-icons foursquare5
data-slice-typesocial-icons flickr5
alignment-right responsive-wrapperstacked5
data-slice-typesocial-icons pinterest5
data-slice-typesocial-icons vimeo5
alignment-center responsive-wrapperstacked5
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-slice-typebody5
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-underlined data-compound-typepopup-overlay-action5
lock-style-regular data-slice-typelock5
data-slice-typesocial-iconshover icon-wrapper5
ease-outopacity 170ms5
170ms ease-outopacity5
0ms 0ms5
data-slice-typesocial-icons youtube5
data-slice-typesocial-icons yelp5
data-slice-typesocial-icons facebook5
data-slice-typesocial-icons vsco5
data-slice-typesocial-icons vine5
data-slice-typesocial-icons vevo5
data-slice-typesocial-icons rdio5
data-slice-typesocial-icons twitter5
data-slice-typesocial-icons twitch5
data-slice-typesocial-icons tumblr5
data-slice-typesocial-icons tidal5
data-slice-typesocial-icons thedots5
data-slice-typesocial-icons stumbleupon5
data-slice-typesocial-icons stitcher5
data-slice-typesocial-icons squarespace5
data-slice-typesocial-icons spotify5
data-slice-typesocial-icons soundcloud5
data-slice-typesocial-icons snapchat5
data-slice-typesocial-icons smugmug5
data-slice-typesocial-icons rss5
data-slice-typesocial-icons reddit5
data-slice-typesocial-icons fivehundredpix5
data-slice-typesocial-icons houzz5
data-slice-typesocial-icons email5
2s 2s5
data-slice-typesocial-icons applepodcast5
data-slice-typesocial-icons bandsintown5
data-slice-typesocial-icons behance5
data-slice-typesocial-icons codepen5
sqs-slide-wrapperdata-slide-typecover-page data-slice-typebuttons5
data-slice-typealbum sqs-slice-album-playlistplaying5
data-slice-typesocial-icons dribbble5
asqs-slide-wrapperdata-slide-typecover-page button-style-outline5
data-slice-typesocial-icons dropbox5
data-slice-typepassword inputtypepassword-moz-placeholdercolorfffsqs-slide-wrapperdata-slide-typecover-page4
data-slice-typesocial-iconshover twitterhover4
data-slice-typesocial-iconshover twitter4
data-slice-typesocial-iconshover twitchhover4
data-slice-typesocial-iconshover email4
data-slice-typesocial-iconshover tumblrhover4
data-slice-typesocial-iconshover tumblr4
data-slice-typesocial-iconshover tidalhover4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-compound-typepopup-overlay-action4
data-slice-typesocial-iconshover tidal4
data-slice-typesocial-iconshover thedotshover4
data-slice-typesocial-iconshover stumbleuponhover4
data-slice-typesocial-iconshover thedots4
data-slice-typesocial-iconshover stumbleupon4
data-slice-typesocial-iconshover stitcherhover4
data-slice-typesocial-iconshover stitcher4
data-slice-typesocial-iconshover squarespacehover4
responsive-wrapperstacked sqs-slice-custom-form4
data-slice-typesocial-iconshover squarespace4
data-slice-typesocial-iconshover spotifyhover4
data-slice-typesocial-iconshover spotify4
data-slice-typesocial-iconshover soundcloudhover4
data-slice-typesocial-iconshover soundcloud4
data-slice-typesocial-iconshover vevo4
data-slice-typesocial-iconshover vevohover4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-slice-typebuttons4
data-compound-typepopup-overlay-action inputtypetextsqs-slide-wrapperdata-slide-typecover-page4
lock-style-border data-slice-typelock4
data-slice-typetwitternotdata-compound-type tweet-body4
data-slice-typealbumhover icon-wrapperhover4
data-slice-typealbumhover icon-wrapper4
audio-player-icons-style-solid data-slice-typealbumhover4
svgsocial-webkit-transitionbackground-color 170ms4
actionsnotstacked input-wrappernothidden4
buttonsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline4
form-wrapper p4
data-slice-typebuttons lisqs-slide-wrapperdata-slide-typecover-page4
data-slice-typesocial-iconshover youtubehover4
data-slice-typesocial-iconshover vimeo4
data-slice-typesocial-iconshover youtube4
data-slice-typesocial-iconshover yelphover4
data-slice-typesocial-iconshover yelp4
data-compound-typepopup-overlay-action inputtypetext-moz-placeholdercolorrgba1631631635sqs-slide-wrapperdata-slide-typecover-page4
data-slice-typesocial-iconshover vscohover4
data-slice-typesocial-iconshover vsco4
data-slice-typesocial-iconshover snapchat4
data-slice-typesocial-iconshover vinehover4
data-slice-typesocial-iconshover vine4
data-slice-typesocial-iconshover vimeohover4
data-slice-typesocial-iconshover snapchathover4
data-slice-typesocial-iconshover twitch4
data-slice-typesocial-iconshover smugmughover4
data-slice-typesocial-iconshover fivehundredpix4
data-slice-typesocial-iconshover ituneshover4
data-slice-typesocial-iconshover itunes4
data-slice-typesocial-iconshover instagramhover4
data-slice-typesocial-iconshover instagram4
data-slice-typesocial-iconshover githubhover4
data-slice-typesocial-iconshover imdbhover4
data-slice-typesocial-iconshover imdb4
data-slice-typesocial-iconshover behancehover4
data-slice-typesocial-iconshover houzzhover4
data-slice-typesocial-iconshover houzz4
data-slice-typesocial-iconshover googlehover4
data-slice-typesocial-iconshover google4
data-slice-typesocial-iconshover codepen4
data-slice-typesocial-iconshover dropbox4
data-slice-typesocial-iconshover googleplayhover4
data-slice-typesocial-iconshover googleplay4
data-slice-typesocial-iconshover codepenhover4
data-slice-typesocial-iconshover goodreadshover4
data-slice-typesocial-iconshover fivehundredpixhover4
data-slice-typesocial-iconshover flickr4
data-slice-typesocial-iconshover flickrhover4
data-slice-typesocial-iconshover dribbblehover4
data-slice-typesocial-iconshover goodreads4
data-slice-typesocial-iconshover foursquare4
data-slice-typesocial-iconshover foursquarehover4
data-slice-typesocial-iconshover dribbble4
data-slice-typesocial-iconshover bandsintownhover4
data-slice-typesocial-iconshover behance4
data-slice-typesocial-iconshover linkedin4
data-slice-typesocial-iconshover pinteresthover4
data-slice-typesocial-iconshover smugmug4
data-slice-typesocial-iconshover emailhover4
data-slice-typesocial-iconshover rsshover4
data-slice-typesocial-iconshover rss4
social-icons-style-regular data-slice-typesocial-icons4
data-slice-typesocial-iconshover reddithover4
data-slice-typesocial-iconshover dropboxhover4
data-slice-typesocial-iconshover reddit4
data-slice-typesocial-iconshover linkedinhover4
data-slice-typesocial-iconshover rdiohover4
data-slice-typesocial-iconshover facebook4
data-slice-typesocial-iconshover rdio4
data-slice-typesocial-iconshover applepodcast4
data-slice-typesocial-iconshover github4
data-slice-typesocial-iconshover meetup4
data-slice-typesocial-iconshover mediumhover4
data-slice-typesocial-iconshover pinterest4
data-slice-typesocial-iconshover bandsintown4
data-slice-typesocial-iconshover applepodcasthover4
data-slice-typesocial-iconshover meetuphover4
data-slice-typesocial-iconshover medium4
data-slice-typesocial-iconshover facebookhover4
lock-style-solid data-slice-typelock3
ease-in-ms-transitionopacity 2s3
inputtypetextsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
lock-style-knockout data-slice-typelock3
data-slice-typelock use-backgroundfilltransparentsqs-slide-wrapperdata-slide-typecover-page3
data-slice-typegallery gallery-video-backgroundmobile3
actionsstacked input-wrappernothidden3
data-slice-typetwitternotdata-compound-type tweet-timestamp3
2s ease-in-ms-transitionopacity3
li ahoversqs-slide-wrapperdata-slide-typecover-page3
2s ease-intransitionopacity3
ease-intransitionopacity 2s3
sqs-slide-containerdata-slide-typepopup-overlay captcha-container-wrapper3
data-compound-typepopup-overlay-action error-messagesqs-slide-wrapperdata-slide-typecover-page3
field-errordisplayblockpositionabsolutebox-sizingborder-boxpadding25em 5emfont14px3
importantsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
ease-in-o-transitionopacity 2s3
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-stacked input-wrapper3
2s ease-in-o-transitionopacity3
ease-in-moz-transitionopacity 2s3
actionsstacked input-wrapper3
2s ease-in-moz-transitionopacity3
importantsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containernotauto-image-background-color3
form-itemsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
data-slice-typemap gm-style-cc3
social-icons-style-solid data-slice-typesocial-icons3
data-slice-typepassword arrow-icon3
ease-in-outsqs-slide-wrapperdata-slide-typecover-page social-icons-style-solid3
sqs-slice-custom-form spansqs-slide-wrapperdata-slide-typecover-page3
data-compound-typepopup-overlay-action buttontypesubmitsqs-slide-wrapperdata-slide-typecover-page3
data-slice-typetwitter tweet-avatar3
asqs-slide-wrapperdata-slide-typecover-page data-slice-typetwitter3
data-slice-typepassword inputtypepasswordsqs-slide-wrapperdata-slide-typecover-page3
2s easesqs-slide-wrapperdata-slide-typecover-page3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-smallsocial-icons-style-knockout3
data-slice-typemap gmnoprint3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-smallsocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-smallsocial-icons-style-knockout3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-smallsocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-mediumsocial-icons-style-knockout3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-mediumsocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-largesocial-icons-style-knockout3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-largesocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-largesocial-icons-style-solid3
data-slice-typebuttons ulstacked3
p asqs-slide-wrapperdata-slide-typecover-page3
social-icons-style-knockout data-slice-typesocial-icons3
inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page button-style-outline3
data-slice-typesocial-icons use-maskfilltransparentsqs-slide-wrapperdata-slide-typecover-page3
data-slice-typesocial-icons svgsocialbackground-colortransparentsqs-slide-wrapperdata-slide-typecover-page3
audio-player-icons-style-regular data-slice-typealbum3
data-slice-typealbum track-title3
form-wrapper inputtypesubmithoversqs-slide-wrapperdata-slide-typecover-page3
sqs-slice-custom-form ahoversqs-slide-wrapperdata-slide-typecover-page3
data-slice-typebuttons ahoversqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline-auto data-slice-typebuttons3
p ahoversqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-auto data-slice-typebuttons3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline data-slice-typebuttons3
data-slice-typealbum sqs-slice-album-playlistdemo-album3
data-slice-typealbum sqs-slice-album-playliststacked3
countdown-contentdata-formattextual countdown-unit3
only screen3
sqs-slide-wrapperdata-slide-typecover-page data-slice-typecountdown3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-largesocial-icons-style-knockout3
sqs-slide-wrapperdata-slide-typecover-page responsive-wrappernotstacked3
data-slice-typesocial-icons440
data-slice-typesocial-iconshover364
social-icons-color-standardsocial-icons-style-solid264
social-icons-color-standardsocial-icons-style-border176
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page137
social-icons-color-standardsocial-icons-style-knockout132
social-icons-color-standardsocial-icons-style-regular132
data-slice-typealbum109
170ms90
data-slice-typebuttons63
data-compound-typepopup-overlay-action60
sqs-slide-containerdata-slide-typepopup-overlay55
icon-wrappersqs-slide-wrapperdata-slide-typecover-page46
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typecover-page44
2s41
asqs-slide-wrapperdata-slide-typecover-page39
data-slice-typecountdown35
importantsqs-slide-wrapperdata-slide-typecover-page35
data-slice-typegallery33
responsive-wrapperstacked31
data-slice-typelock30
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline29
data-slice-typepassword29
form-wrapper28
sqs-album-minimal27
ul26
0sqs-slide-wrapperdata-slide-typecover-page25
1s25
sqs-modal-lightbox-content25
sqs-slice-custom-form25
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page24
icon-wrapper23
lightbox-inner22
data-slice-typenavigation21
li21
sqs-slide-wrapperdata-slide-typecover-page20
socialstacked20
socialstackedtext-align-left20
020
lightbox-content19
button-style-outline19
data-slice-typebody18
countdown-contentdata-formatnumeric18
ease-in-outsqs-slide-wrapperdata-slide-typecover-page17
sqs-slice-album-playlist17
all17
tracks16
border-color15
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled15
ease-in-out15
gallery-video-background14
sqs-modal-lightbox-open14
ahoversqs-slide-wrapperdata-slide-typecover-page13
p13
actionsnotstacked12
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page12
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page12
lisqs-slide-wrapperdata-slide-typecover-page12
icon-wrapperhover12
0px12
social-icons-style-solid12
password-style-rectangle11
countdown-contentdata-formattextual11
actionsstacked11
data-slice-typetwitter11
password-style-underlined11
sqs-slice-play-buttonicon-wrappersqs-slide-wrapperdata-slide-typecover-page10
0ms10
solid10
squarespace10
110
icon-wrapperlast-childsqs-slide-wrapperdata-slide-typecover-page10
data-slice-typetwitternotdata-compound-type10
icon-wrapperlast-childmargin-right0sqs-slide-wrapperdata-slide-typecover-page10
stumbleupon9
vevo9
yelp9
facebook9
email9
vsco9
rdio9
vine9
dropbox9
reddit9
dribbble9
vimeo9
twitter9
fivehundredpix9
twitch9
rss9
tumblr9
tidal9
thedots9
codepen9
smugmug9
behance9
stitcher9
snapchat9
bandsintown9
spotify9
applepodcast9
youtube9
pinterest9
soundcloud9
foursquare9
goodreads9
github9
max-width600pxsqs-slide-wrapperdata-slide-typecover-page9
instagram9
googleplay9
imdb9
linkedin9
itunes9
medium9
meetup9
ease-in-out-moz-transitionbackground-color9
ease-in-out-ms-transitionbackground-color9
ease-in-out-o-transitionbackground-color9
ease-in-outtransitionbackground-color9
flickr9
houzz9
google9
data-slice-typealbumhover8
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline8
ulsqs-slide-wrapperdata-slide-typecover-page8
sqs-slice-play-buttonicon-wrapper8
sqs-slide-containerdata-slide-typepopup-overlayoverlay-alignment-center8
track7
social-icons-style-border7
show-track-title7
input-wrappernothidden7
video-icon-style-border7
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page7
data-slice-typemap7
spansqs-slide-wrapperdata-slide-typecover-page7
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-stacked7
use-backgroundfillfffsqs-slide-wrapperdata-slide-typecover-page7
alignment-right7
inputtypetextsqs-slide-wrapperdata-slide-typecover-page7
use-backgroundfilltransparentsqs-slide-wrapperdata-slide-typecover-page7
button-style-outlinesqs-modal-lightbox7
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typecover-page6
sqs-slide-containerdata-slide-typepopup-overlayoverlay-alignment-left6
alignment-center6
2em6
sqs-slice-play-buttonicon-wrapperhover6
10px6
track-progress-bar6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-outline6
social-icons-style-regular6
button-style-raised6
ulstacked6
inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-rectangle6
input-wrapper6
audio-player-icons-style-border6
audio-player-icons-style-solid6
snapchathover5
mediumhover5
sqs-slide-layer-content5
meetuphover5
youtubehover5
ease-outopacity5
lock-style-regular5
linkedinhover5
no-vh5
ituneshover5
100ms5
instagramhover5
social-icons-style-knockout5
imdbhover5
yelphover5
vinehover5
pinteresthover5
thedotshover5
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-underlined5
soundcloudhover5
spotifyhover5
squarespacehover5
smugmughover5
stitcherhover5
use-maskfilltransparentsqs-slide-wrapperdata-slide-typecover-page5
rsshover5
stumbleuponhover5
tidalhover5
vscohover5
tumblrhover5
twitchhover5
twitterhover5
vevohover5
vimeohover5
reddithover5
buttonsqs-slide-wrapperdata-slide-typecover-page5
rdiohover5
01s5
houzzhover5
foursquarehover5
googlehover5
fivehundredpixhover5
button-shape-pill5
button-shape-rounded-corners5
applepodcasthover5
gmnoprint5
bandsintownhover5
gm-style-cc5
behancehover5
codepenhover5
sqs-slice-album-playlistplaying5
dribbblehover5
6px5
dropboxhover5
emailhover5
tweet-timestamp5
facebookhover5
audio-player-icons-style-regular5
githubhover5
googleplayhover5
flickrhover5
goodreadshover5
svgsocial-webkit-transitionbackground-color5
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-raised4
map-style-minimal-dark4
displaytablesqs-slide-wrapperdata-slide-typecover-page4
inputtypetext-moz-placeholdercolorrgba1631631635sqs-slide-wrapperdata-slide-typecover-page4
form-itemsqs-slide-wrapperdata-slide-typecover-page4
video-icon-style-regular4
tweet-body4
4px4
track-title4
inputtypepassword-moz-placeholdercolorfffsqs-slide-wrapperdata-slide-typecover-page4
use-iconfilltransparentsqs-slide-wrapperdata-slide-typecover-page4
neuearialsans-seriffont-weightnormalfont-stylenormalletter-spacing6pxsqs-slide-wrapperdata-slide-typecover-page4
lock-style-border4
5px4
audio-player-icons-style-knockout4
icon-wrapperwidth24pxheight24pxmargin04
video-icon-style-solid4
data-slice-typebodysqs-slide-wrapperdata-slide-typecover-page4
max-width1020px4
social-icons-size-extra-largesocial-icons-style-knockout3
use-iconfille0393esqs-slide-wrapperdata-slide-typecover-page3
use-iconfillec4652sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill4183c4sqs-slide-wrapperdata-slide-typecover-page3
icon-wrapperdiv-webkit-transformscale2-moz-transformscale2-ms-transformscale2transformscale2sqs-slide-wrapperdata-slide-typecover-page3
use-iconfillf94877sqs-slide-wrapperdata-slide-typecover-page3
lock-style-solid3
use-iconfill0976b4sqs-slide-wrapperdata-slide-typecover-page3
lock-style-knockout3
use-iconfill0063dcsqs-slide-wrapperdata-slide-typecover-page3
use-iconfill00ab6csqs-slide-wrapperdata-slide-typecover-page3
3px3
video-icon-style-knockout3
icon-wrapperwidth28pxheight28pxmargin03
use-iconfill0099e5sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill3b5998sqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-containerdata-slide-typepopup-overlaybutton-style-outline3
icon-wrapperwidth32pxheight32pxmargin03
use-iconfillcc2127sqs-slide-wrapperdata-slide-typecover-page3
icon-wrapperwidth36pxheight36pxmargin03
use-iconfill006ed2sqs-slide-wrapperdata-slide-typecover-page3
use-iconfillfffbackground-colorfffsqs-slide-wrapperdata-slide-typecover-page3
use-iconfill007ee5sqs-slide-wrapperdata-slide-typecover-page3
7px3
use-iconfillff4500sqs-slide-wrapperdata-slide-typecover-page3
svgsocialbackground-colortransparentsqs-slide-wrapperdata-slide-typecover-page3
use-iconfill444sqs-slide-wrapperdata-slide-typecover-page3
button-play-pause3
use-iconfillea4c89sqs-slide-wrapperdata-slide-typecover-page3
sqs-slice-album-playlistdemo-album3
use-iconfill382110sqs-slide-wrapperdata-slide-typecover-page3
captcha-container-wrapper3
sqs-slice-album-playliststacked3
use-iconfille6b91esqs-slide-wrapperdata-slide-typecover-page3
enable-page-bordersqs-slide-container3
responsive-wrapper3
sqs-slicedata-content-emptytruedisplaynonesqs-slide-wrapperdata-slide-typecover-page3
responsive-wrappernotstacked3
use-iconfilldc4e41sqs-slide-wrapperdata-slide-typecover-page3
adisplayblocksqs-slide-wrapperdata-slide-typecover-page3
responsive-wrapperstackedtext-align-center3
sqs-slide-containerdata-slide-typepopup-overlayenable-overlay-content-border3
actionssqs-slide-wrapperdata-slide-typecover-page3
autoflex13
autosqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-containerdata-slide-typepopup-overlayoverlay-load-animation-slide-in3
sqs-slidesqs-slide-animation-ready3
60px3
gallery-video-backgroundmobile3
use-iconfill5adfcbsqs-slide-wrapperdata-slide-typecover-page3
data-slice-typebuttonssqs-slide-wrapperdata-slide-typecover-page3
sqs-slice-custom-formsqs-slide-wrapperdata-slide-typecover-page3
error-messagesqs-slide-wrapperdata-slide-typecover-page3
data-compound-typelogo3
data-slice-typegallerysqs-gallery-grid3
use-iconfille4405fsqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-containernotauto-image-background-color3
ease-in-moz-transitionopacity3
ease-in-ms-transitionopacity3
5emfont14px3
field-errordisplayblockpositionabsolutebox-sizingborder-boxpadding25em3
ease-in-o-transitionopacity3
ease-intransitionopacity3
inputtypesubmithoversqs-slide-wrapperdata-slide-typecover-page3
button-style-solid3
social-icons-size-extra-largesocial-icons-style-border3
use-iconfill6441a5sqs-slide-wrapperdata-slide-typecover-page3
arrow-icon3
use-iconfill00b488sqs-slide-wrapperdata-slide-typecover-page3
14px3
social-icons-size-extra-smallsocial-icons-style-regular3
use-iconfill1ab7easqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-smallsocial-icons-style-regular3
social-icons-size-mediumsocial-icons-style-regular3
use-iconfillff0031sqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-largesocial-icons-style-regular3
8px3
use-iconfill55aceesqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-extra-largesocial-icons-style-regular3
social-icons-size-extra-smallsocial-icons-style-border3
social-icons-size-extra-smallsocial-icons-style-knockout3
use-iconfillae995asqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-extra-smallsocial-icons-style-solid3
use-iconfill35465dsqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-smallsocial-icons-style-border3
social-icons-size-smallsocial-icons-style-knockout3
social-icons-size-smallsocial-icons-style-solid3
social-icons-size-mediumsocial-icons-style-border3
use-iconfill8c8070sqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-mediumsocial-icons-style-knockout3
social-icons-size-mediumsocial-icons-style-solid3
use-iconfilleb4924sqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-largesocial-icons-style-border3
social-icons-size-largesocial-icons-style-knockout3
use-iconfill1ea9e1sqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-largesocial-icons-style-solid3
easesqs-slide-wrapperdata-slide-typecover-page3
inputtypepasswordsqs-slide-wrapperdata-slide-typecover-page3
only3
use-iconfillf60sqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline-auto3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-auto3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline3
screen3
ease-in-outtransitioncolor3
ease-in-out-o-transitioncolor3
ease-in-out-ms-transitioncolor3
ease-in-out-moz-transitioncolor3
use-iconfill1769ffsqs-slide-wrapperdata-slide-typecover-page3
use-iconfill7dbb00sqs-slide-wrapperdata-slide-typecover-page3
countdown-unit3
use-iconfill00b4b3sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill000sqs-slide-wrapperdata-slide-typecover-page3
disclaimer-containersqs-slide-wrapperdata-slide-typecover-page3
avisitedsqs-slide-wrapperdata-slide-typecover-page3
buttontypesubmitsqs-slide-wrapperdata-slide-typecover-page3
1px3
icon-wrapperborder2px3
data-slice-typeheadingnotdata-compound-type3
use-iconfill7ac143sqs-slide-wrapperdata-slide-typecover-page3
max-width1020pxsqs-slide-wrapperdata-slide-typecover-page3
sqs-modal-lightbox3
social-icons-size-extra-largesocial-icons-style-solid3
tweet-avatar3
tweet-display-name3
use-iconfille52d27sqs-slide-wrapperdata-slide-typecover-page3
tweet-handle3
use-iconfill84bd00sqs-slide-wrapperdata-slide-typecover-page3
use-iconfillc41200sqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-layersplit-fifty3

Who hosts Redtentacle.ca?

Redtentacle.ca Hosting Provider Information

Hosted IP Address:198.49.23.144
Hosted Hostname:198.49.23.144
Service Provider:Squarespace, Inc.
Hosted Country:United StatesUS
Location Latitude:40.7157
Location Longitude:-74
Webserver Software:Squarespace

Is "Squarespace, Inc." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%
Squarespace, Inc.
1.2345%

HTTP Header Analysis for Redtentacle.ca

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
date: Sat, 21 Nov 2020 08:04:05 GMT
strict-transport-security: max-age=0
expires: Thu, 01 Jan 1970 00:00:00 GMT
x-content-type-options: nosniff
content-type: text/html;charset=utf-8
content-encoding: gzip
etag: W/"4ea6f937fd116898216a9ea4c3e9fd96"
content-length: 29106
Vary: Accept-Encoding
Age: 455927
Accept-Ranges: bytes
x-contextid: 5eMRHEUX/4ri0nAQ2
server: Squarespace

Redtentacle.ca Domain Nameserver Information

HostIP AddressCountry
ns01.domaincontrol.com 97.74.100.1
ns02.domaincontrol.com 173.201.68.1


Need to find out who hosts Redtentacle.ca?


Domain Registration (WhoIs) information for Redtentacle.ca

 Domain Name: redtentacle.ca
Registry Domain ID: D1445196-CIRA
Registrar WHOIS Server: whois.ca.fury.ca
Registrar URL: ca.godaddy.com
Updated Date: 2019-08-09T11:37:17Z
Creation Date: 2010-08-08T23:53:59Z
Registry Expiry Date: 2021-08-08T04:00:00Z
Registrar: Go Daddy Domains Canada, Inc
Registrar IANA ID: not applicable
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registry Registrant ID: REDACTED FOR PRIVACY
Registrant Name: REDACTED FOR PRIVACY
Registrant Organization: REDACTED FOR PRIVACY
Registrant Street: REDACTED FOR PRIVACY
Registrant City: REDACTED FOR PRIVACY
Registrant State/Province: REDACTED FOR PRIVACY
Registrant Postal Code: REDACTED FOR PRIVACY
Registrant Country: REDACTED FOR PRIVACY
Registrant Phone: REDACTED FOR PRIVACY
Registrant Phone Ext: REDACTED FOR PRIVACY
Registrant Fax: REDACTED FOR PRIVACY
Registrant Fax Ext: REDACTED FOR PRIVACY
Registrant Email: Please ask the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Other contacts of the queried domain name
Registry Admin ID: REDACTED FOR PRIVACY
Admin Name: REDACTED FOR PRIVACY
Admin Organization: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin City: REDACTED FOR PRIVACY
Admin State/Province: REDACTED FOR PRIVACY
Admin Postal Code: REDACTED FOR PRIVACY
Admin Country: REDACTED FOR PRIVACY
Admin Phone: REDACTED FOR PRIVACY
Admin Phone Ext: REDACTED FOR PRIVACY
Admin Fax: REDACTED FOR PRIVACY
Admin Fax Ext: REDACTED FOR PRIVACY
Admin Email: Please ask the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Other contacts of the queried domain name
Registry Tech ID: REDACTED FOR PRIVACY
Tech Name: REDACTED FOR PRIVACY
Tech Organization: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech City: REDACTED FOR PRIVACY
Tech State/Province: REDACTED FOR PRIVACY
Tech Postal Code: REDACTED FOR PRIVACY
Tech Country: REDACTED FOR PRIVACY
Tech Phone: REDACTED FOR PRIVACY
Tech Phone Ext: REDACTED FOR PRIVACY
Tech Fax: REDACTED FOR PRIVACY
Tech Fax Ext: REDACTED FOR PRIVACY
Tech Email: Please ask the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Other contacts of the queried domain name
Registry Billing ID: REDACTED FOR PRIVACY
Billing Name: REDACTED FOR PRIVACY
Billing Organization: REDACTED FOR PRIVACY
Billing Street: REDACTED FOR PRIVACY
Billing City: REDACTED FOR PRIVACY
Billing State/Province: REDACTED FOR PRIVACY
Billing Postal Code: REDACTED FOR PRIVACY
Billing Country: REDACTED FOR PRIVACY
Billing Phone: REDACTED FOR PRIVACY
Billing Phone Ext: REDACTED FOR PRIVACY
Billing Fax: REDACTED FOR PRIVACY
Billing Fax Ext: REDACTED FOR PRIVACY
Billing Email: Please ask the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Other contacts of the queried domain name
Name Server: ns01.domaincontrol.com
Name Server: ns02.domaincontrol.com
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2020-11-26T14:42:54Z

Websites with Similar Names

Redtea.best
401 Authorization Required
Redtea.com
RedTea News - Independent News For The Right Minded American
Redtea.kr
홍차넷
Redtea.space
Домен не прилинкован ни к одной из директорий на сервере!
Redteacafe.com
redteacafe.com - Registered at Namecheap.com
Redteachers.com
Welcome to REd Teachers - teaching positions in the UK and beyond!
Redteadetoxcleanse.com
The Red Tea Detox Cleanse - Burn off the pounds!

Recently Updated Websites

Nooitmeervliegangst.space (1 second ago.)Sexylingerie.supply (1 second ago.)Aclearerpespective.com (2 seconds ago.)Acrholdingsinc.com (2 seconds ago.)Remotetreatmentsolutions.us (2 seconds ago.)Ashdub.com (3 seconds ago.)5234y0.com (3 seconds ago.)Aditispicedepot.com (3 seconds ago.)Nervecgedx.site (3 seconds ago.)Akcyberconsulting.com (3 seconds ago.)Anjinglakau03.com (4 seconds ago.)Allthelawyers.com (4 seconds ago.)Amandakot.com (4 seconds ago.)Susterotyr.space (4 seconds ago.)Catalystpress.us (4 seconds ago.)Adtocarts.com (5 seconds ago.)Lilasquad.tech (5 seconds ago.)French-classes.site (5 seconds ago.)Theveil.space (5 seconds ago.)Saturexkjg.site (5 seconds ago.)Nooitmeervliegangst.online (5 seconds ago.)Asociacionpdav.com (6 seconds ago.)Arkhecollection.com (6 seconds ago.)Tango-video.online (6 seconds ago.)Adoborolls.com (6 seconds ago.)Austria5g.com (7 seconds ago.)Traduate.tech (7 seconds ago.)Brianaamorcoin.space (7 seconds ago.)Andmayari.com (7 seconds ago.)Alharaazcoffee.com (7 seconds ago.)

Recently Searched Keywords

255 importantcomp-k9rzsywb pro-galleryinline-styles (1 second ago.)trip price (4 seconds ago.)take care (6 seconds ago.)corlu1osb (8 seconds ago.)operatic (9 seconds ago.)fika (9 seconds ago.)系列 (10 seconds ago.)persa (10 seconds ago.)no agents (12 seconds ago.)گمشده سگ تریر (13 seconds ago.)сочетания клавиш (14 seconds ago.)caterina scorsone (15 seconds ago.)request of district (16 seconds ago.)bethenny frankel (17 seconds ago.)สินค้าที่หมดแล้ว [2678] (19 seconds ago.)sankom (19 seconds ago.)thisfindmerchantnametext (22 seconds ago.)buy book itunes (24 seconds ago.)mayo tasarm (24 seconds ago.)width 1700px (25 seconds ago.)cloud applications (27 seconds ago.)招投标 (28 seconds ago.)uhttphttp (29 seconds ago.)unhinged (30 seconds ago.)your business fitkeeping (32 seconds ago.)which ayurvedic oil is good for your body massage (34 seconds ago.)rencontrer nos (34 seconds ago.)fohow oral liquid (37 seconds ago.)charcuterie boards (37 seconds ago.)stevenson (38 seconds ago.)