Reedsrains.co.uk  |  Estate Agents and Letting Agents | Reeds Rains
Low trust score  | 
Reeds Rains estate agents offers estate agency and lettings services across England, North Wales and Northern Ireland - established in 1868

Reedsrains.co.uk Website Information

Reedsrains.co.uk has a Low Trust Score, a Statvoo Rank of G, an Alexa Rank of 324,536, a Majestic Rank of 618,957, a Domain Authority of 36% and is not listed in DMOZ.

Reedsrains.co.uk is hosted by 1&1 Internet AG in England, Gloucester, United Kingdom, Gl1 5pn.
Reedsrains.co.uk has an IP Address of 213.171.222.77 and a hostname of www.regentcentre.co.uk and runs Microsoft-IIS/8.5 web server.

The domain reedsrains.co.uk was registered 2 decades 1 year 8 months ago by , it was last modified 4 years 2 weeks 4 days ago and currently is set to expire 201 decades 8 years 9 months ago.


Whois information for reedsrains.co.uk

Full Whois Lookup for Reedsrains.co.uk Whois Lookup

Domain name:
reedsrains.co.uk

Registrant:
your-move.co.uk limited

Registrant type:
Unknown

Registrant's address:
Newcastle House, Albany Court,
Newcastle Business Park
Newcastle upon Tyne
NE4 7YB
United Kingdom

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 01-Feb-2017

Registrar:
Gandi [Tag = GANDI]
URL: http://www.gandi.net

Relevant dates:
Registered on: 24-Oct-1997
Expiry date: 24-Oct-2023
Last updated: 01-Feb-2017

Registration status:
Registered until expiry date.

Name servers:
gordon.ns.cloudflare.com
lara.ns.cloudflare.com

WHOIS lookup made at 08:08:31 17-Aug-2017

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2017.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at http://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Who hosts Reedsrains.co.uk?

Reedsrains.co.uk Web Server Information

Hosted IP Address:213.171.222.77
Hosted Hostname:www.regentcentre.co.uk
Service Provider:1&1 Internet AG
Hosted Country:United KingdomGB
Location Latitude:51.8657
Location Longitude:-2.2431
Webserver Software:Microsoft-IIS/8.5

HTTP Header Analysis for Reedsrains.co.uk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Vary: Accept-Encoding
Server: Microsoft-IIS/8.5
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Tue, 21 Jul 2015 14:02:51 GMT
Content-Length: 11894


Need to find out who hosts Reedsrains.co.uk?

Reedsrains.co.uk Free SEO Report

Website Inpage Analysis for Reedsrains.co.uk

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Reedsrains.co.uk

your dream homescriptonloaddream homefree propertynbspvaluationfeerainsnewsmoreinstanthomesinstant onlinesellchargethinking of sellingreeds rainsconductletallscriptonreadystatechangeyouronlineprotectionlatestfilemybookfree instantpropertyreedssaynewservicerentalamounthouseyour dreambuyerspropertynbspvaluation thinkingusourdreammortgagefindyousellingkeepsalenewcallbackfree instant onlineheadamplimitedbook a freehomeestate agentslooking for yourhavepackagesellerlookingwe will chargevaroldwindowonloadselling getthinkinghome lookingfaqswindowheightrequiredheaderheightvaluationoneamp newregulationsservicesagentsnotifgetestatebuyingviewevoloadwelandlordspropertynbspvaluationapplicationlocalmayinsuranceusesalelandcontactbranchfreealertsbuildingif youdoyour freefunctionsalenew homes

Longtail Keyword Density for Reedsrains.co.uk

KeywordsOccurences
we will charge4
book a free3
thinking of selling3
your dream home3
looking for your3
free instant online3
reeds rains11
amp new4
instant online4
propertynbspvaluation thinking3
selling get3
free propertynbspvaluation3
estate agents3
your free3
dream home3
if you3
home looking3
your dream3
salenew homes3
free instant3
your19
reeds18
we16
our14
var12
rains12
free12
you12
function11
mortgage9
home9
property8
selling7
charge6
may6
book5
have5
more5
branch5
all5
let5
if5
buyers5
new5
homes5
house5
required4
amount4
get4
propertynbspvaluation4
news4
instant4
online4
looking4
application4
not4
fee4
rental4
say4
amp4
use4
service3
one3
building3
headerheight3
local3
find3
callback3
conduct3
limited3
scriptonreadystatechange3
scriptonload3
oldwindowonload3
latest3
windowheight3
evoload3
head3
services3
sell3
landlords3
protection3
regulations3
faqs3
contact3
view3
buying3
saleland3
salenew3
do3
keep3
dream3
thinking3
valuation3
estate3
us3
filemy3
packageseller3
alerts3
insurance3
agents3

What are the nameservers for reedsrains.co.uk?

Reedsrains.co.uk Domain Nameserver Information

HostIP AddressCountry
ns-1291.awsdns-33.org 205.251.197.11United States United States
ns-144.awsdns-18.com 205.251.192.144United States United States
ns-1589.awsdns-06.co.uk 205.251.198.53United States United States
ns-922.awsdns-51.net 205.251.195.154United States United States

Reedsrains.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Reedsrains.co.uk is a scam?