Reiseland-brandenburg.de  |  Reiseland Brandenburg: Ihr Portal für Urlaub und Ausflüge
Low trust score  | 
Erleben Sie einen Urlaub oder Ausflug in Brandenburg: 3000 Seen, ein perfektes Fahrradnetz und viel Natur direkt vor den Toren Berlins laden Sie ein.




Reiseland-brandenburg.de Website Information

Website Ranks & Scores for Reiseland-brandenburg.de

Statvoo Rank Statvoo Rank:G
Alexa Rank Alexa Rank:477,431
Majestic Rank Majestic Rank:192,241
Domain Authority Domain Authority:63%
DMOZ DMOZ Listing:No

Whois information for reiseland-brandenburg.de

Full Whois Lookup for Reiseland-brandenburg.de Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Reiseland-brandenburg.de. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

% Copyright (c) 2010 by DENIC
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%

Domain: reiseland-brandenburg.de
Nserver: dns1.netzhaus.ag
Nserver: dns2.netzhaus.ag
Nserver: dns3.netzhaus.ag
Nserver: dns4.netzhaus.ag
Status: connect
Changed: 2016-07-07T11:07:33+02:00

[Tech-C]
Type: PERSON
Name: Jan Hoffmann
Organisation: Tourismus Marketing Brandenburg GmbH
Address: Am Neuen Markt 1
PostalCode: 14467
City: Potsdam
CountryCode: DE
Phone: +49 331 2987370
Fax: +49 331 2987373
Email: Login to show email
2016-04-06T10:18:00+02:00

[Zone-C]
Type: PERSON
Name: Jan Hoffmann
Organisation: Tourismus Marketing Brandenburg GmbH
Address: Am Neuen Markt 1
PostalCode: 14467
City: Potsdam
CountryCode: DE
Phone: +49 331 2987370
Fax: +49 331 2987373
Email: Login to show email
2016-04-06T10:18:00+02:00

Who hosts Reiseland-brandenburg.de?

Reiseland-brandenburg.de is hosted by Versatel Deutschland GmbH in Germany.
Reiseland-brandenburg.de has an IP Address of 89.27.155.171 and a hostname of reiseland-brandenburg.de.



Reiseland-brandenburg.de Web Server Information

Hosted IP Address:89.27.155.171
Hosted Hostname:reiseland-brandenburg.de
Service Provider:Versatel Deutschland GmbH
Hosted Country:GermanyDE
Location Latitude:51
Location Longitude:9
Webserver Software:Not Applicable

HTTP Header Analysis for Reiseland-brandenburg.de

Http-Version: 1.0
Status-Code: 200
Status: 200 OK
Date: Tue, 02 Jun 2015 22:04:18 GMT
Server: Apache
Last-Modified: Wed, 27 May 2015 14:44:24 GMT
Expires: Wed, 03 Jun 2015 22:00:00 GMT
ETag: "09d2befbfd4c8f7fae3b64eb83f5f166"
Cache-Control: max-age=86142
Pragma: public
X-Powered-By: PleskLin
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 13283
Content-Type: text/html; charset=utf-8
Age: 4378
X-Cache: HIT from localhost
X-Cache-Lookup: HIT from localhost:80
Via: 1.0 localhost (squid/3.1.20)
Connection: keep-alive


Need to find out who hosts Reiseland-brandenburg.de?

Reiseland-brandenburg.de Free SEO Report

Website Inpage Analysis for Reiseland-brandenburg.de

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Reiseland-brandenburg.de

neueviele weiterewasser entdecken kultursternschnuppenzeitist derdem flohier tipps zumanabenteuertop ortetipps hierdie sommerlichen temperaturenzu konzerten festenunterm sternenhimmelcampingurlaubapphoher flminglebensmittel ausgefhlder regiontag desfamilienpass brandenburgtiefmit demurlaub gutder region bietenbesondereunsere empfehlung besondereder natur auf20172018 erschienen familienpassdie hoflden imoder restaurantffnengenieen sieneu findenjahrecampingwildpferden augeapp jetztorteregion bieten diefoto tmbfotoarchivsteffen lehmannaufbrechen wirwandern mit demgesuchthistorische bautenist sternschnuppenzeitferienhuser mitesmorgen zu neuenganz nah derbedeutetvergessen wirsindsommers genieen siefr przewalskipferdenordostins wasser amim nordenunterknfteferienhuserhofldenkleine auszeiten ausflugstippstauchenim august isthaben die bestenorte immysterienspiel mit laienschauspielernmit auergewhnlicherbernachtenbrandenburg jedesichreformationmysterienspiel jterboger mysterienspielhuckleberry finnprachtquotberliner umlandnbspmitten in derlandschaft des flmingsraus insfrauge in augeausflugstippssee ein hausbesonders gutzu neuender quoterste sternenparkprsentieren ihnenwildpferdencampingurlaub in brandenburgdielaienschauspielern ausflming wandernempfehlung besondereder perfekte ortuntermein bisschendas bedeutetder neue familienpassins berliner umlandnbspheide ist heimatwillkommenuckermrkische seenahoi flo ahoihohertier und pflanzenartenneuen ufern aufbrechenveranstaltungstipps frschlafen untermtieroder mehrwochenende mal wiederaktuell unsere veranstaltungstippsdurch brandenburglieben das besonderelieben dasberliner umlandnbsp obneuenniveauherunterladen dbquoterste sternenpark deutschlandsquotdie zeit vergessenschlemmendie sternenationalpark untereskulturder natur dereselmit laienschauspielernhchstemnaturlandschaft dberitzerbrandenburg mehrpensionen ferienwohnungen ampbrandenburg das bedeutetgemsemit auergewhnlicher architektur20172018 erschienenauge mit wildpferden10 restauranttippstief durchatmen landlustganz entspanntoffenenjedeaktiv ampdes sommers kulturfestivalsnatur lauschenflusslandschaftquotersteein mysterienspiel mitempfehlungberprachtquot ffnen zumhchstem niveau wirxausflugstipps inshier aktuelle ausflugstippsam morgenwir ihnen ferienhuserlsst esaufgefhrtblickimmerkontakt ampbrandenburgsdie neue appniederlausitzer heidelandschaftaktuelle ausflugstippskonzerten festen ausstellungenfamilien kulturliebhaberfr 549bauten ihrerestauranttipps amseitdannnbspempfehlen wirhistorischeuckermarkfr die sommerferienanreisesie hierwir ihnenhier fngt derlebensmittelauergewhnlicherideen fr erlebnisreicheveranstaltungstippsauge mitdas wasserdenkmals auchseesie kulturspannende historischeffnen zumruppinerdas gefhlkultur in dersanftmtiger langohren wandertbautenist losstttengenieenbrandenburg daswasser gleiten derahoisielmannshavellandam see einhistorische bauten ihreentspanntes paddelerlebnisflming wandern mitfestenwasser gleitendbideenviele weitere seltenekulturfestivals des sommersferienzeit schnstesanftexklusive ausflugstipps durchaufbrechenausflugstipps kleineimmer aktuell unserebrandenburg spannendetipps zuquotmacht und prachtquotbesten tipps4paddelnerschienenihreoder honig hochwertigebarnimer landkanutoursind ferien mittenkontaktformularlehmannwasser genieen hierlecker von hierortnaturpark uckermrkischeschnste zeit tippsdenkmalsbisschen das gefhlferien mittenveranstaltungenbietet 100entschleuniger naturgenieerdahmeseenlandam wochenende malampsee einschlemmen die sommerlichenregionseenzeitspreewald uckermarkbrandenburg mehr erfahrendes flmingsbedeutet abenteuerimmer aktuelleinen tag oderobstnikolaikirchebesten tipps hiererschienen familienpasszum erstendie sterne amam wasser 10ein bisschen daswasser am morgenlandrckenhochwertigenordost bietet 100nah derseit 500honigfinn fr einenwestenferiensielmanns naturlandschaftaktuelle ausflugstipps insein haushochwertige lebensmittelhotels ampdenkmals tag deswiederbrandenburgischeausfluglsst es sichkonzerten festenbrandenburg jede wochesommerlichen temperaturensdenhochwertige lebensmittel ausdurchatmen landlustfr diejterboger mysterienspiel jterbogerelbeelsterland lausitzer seenlandder quotersteniederlausitzerlandlustnaturgenieernaturlandschaftlandschaft deswochenende malnahdannnbspempfehlenfinn frrestauranttippsfr einen tagsich besonders gutauf hchstem niveauihnen die veranstaltungshhepunkteausflugsregionen imhaben dieurlaubkultur erleben tiefwochezumaus derbiergarten odernatur auf hchstemdeutschlandsquotfamilienweitere seltene tierzu konzertenksehchstem niveauberlinersich besondersder perfektedeutschlandsquot ist dersind feriendie zeitamp ferienhuserganz entspannt durchessen amp trinkenmit wildpferden augedeutschlandsquot istheimat fr przewalskipferdemrkische schweizpotsdam spreewaldbehinderungtippskse oderhier und leckergut schlemmenvieleseenlandrestaurant amwirdgehenferienwohnungen ampwandert esprzewalskipferdeeinenort fr sternenliebhabervon hiernaturlandschaftenausflugstipps ins berlinerdurch brandenburg dasausflgeflmingsniederlausitzer landrckenentspannt durchnationalparknuthenieplitzwandert es sichder region aufgefhrtsternenden sternen ganzmitvon huckleberrydannnbspempfehlen wir ihnenheidelandschaftjterbogertheatersommers3gleiten dernatur der500 jahre reformationperfekte ort fr549 freizeitanbietermal wieder rausoffenen denkmals tagkleine auszeitensuchendurch die reizvolleam wasser genieenhuckleberry finn frfr 549 freizeitanbieterbarrierefreie unterknftearchitektursprung insselteneheide istperfektesie hier aktuellefr erlebnisreichewirzum bundesweiten tagdie neueerfahrenlaienschauspielern100 exklusive ausflugstippsmysterienspiel jterbogerunteres odertalveranstaltungshhepunkte deslsstein entspanntes paddelerlebnisins grneauszeiten ausflugstippsobst gemse ksesommerlichendb ausflugwillkommen in brandenburgdurchrabatte frbernachten am wasserherzlich willkommenlandder urlaubhotels amp pensionenentdecken kulturflopensionen ferienwohnungenpaddeln ganzbrandenburg das sinddb ausflug appmenschen mitim berlinerkse oder honigbrandenburgs topferienwohnungendurch den flming5gemse kse oderschnstegenieen sie kulturinsapp derhast und eilemehrsternenhimmel schlafen untermwanderthiermysterienspiel mitjede woche neuunsere veranstaltungstippshabentmbfotoarchivsteffentag oder mehrihnen touren frder urlaub gutdie hofldensommerferienabendim westhavellandfr erlebnisreiche sommerferienbrandenburg frprachtquot ffnenliebeneinemsie hier tippstopdas besonderewesthavelland ist mangleiten der naturnaturparkferienhuser mit auergewhnlicherunter dem titeleinfr sternenliebhaberkultur erlebenwebsiteihnendas bedeutet abenteuerhier tippszeit vergessenauch in brandenburgoft gesuchtreizvolledem titelnaturdb regio nordostfamilienpass brandenburg bietetzeit vergessen wirgrnedes offenen denkmalsseit 500 jahrennaturlandschaft dberitzer heideamp pensionen ferienwohnungendie sommerferiensommers kulturfestivalsgefhl von huckleberrybernachten amgleitenist der perfekteausstellungenauszeitenrestauranttipps am wasserregio nordost bietetufern aufbrechen wirsie lieben500 jahren wirdhaben ihnenmit behinderungder sprungder neuelandschaftbedeutet abenteuer purbegleitung sanftmtigerunseremorgen zulangohren wandert eswasser 10 restauranttippsdergutraussternen ganzjede wocheerlebnisreichefotoneue familienpass brandenburgdem titel quotmachttouren fr einwoche neu findenihnen dieprospektbestellungabenteuer puressentipps und ideenbesondere dannnbspempfehlenrestaurantdem flo durchhier lsst eskulturliebhaber entschleunigerffnen zum bundesweitenjahre reformationschlemmen diemehr erfahrenzum bundesweitentag des offenenexklusive ausflugstippsempfehlung besondere urlaubsquartiereniederlausitzoder honigber das wasserjterboger mysterienspielgut an bernachtenahoi flounsbesondersnordost bietetwird in dermit dem eselins grne findensopaddelerlebnisdes sommerskurortejetzt bestellenjterboger nikolaikircheder dbbietet rabatte frein haus amsommerferien veranstaltungstipps500 jahredurchatmen landlust auslebennordenwandern mitsilbermannbrandenburg fr familienneue app dernikolaikirche einbestenbad saarowdenideen frperfekte ortder jterbogeres sich besonderskulturliebhaber entschleuniger naturgenieergrne finden siedberitzer heide0seenkettetop orte imvergessenentspannt durch diemit laienschauspielern ausuntererschienen familienpass 20172018neue appwasser genieenbestellen derkanues sichdem esel durchsternenhimmel schlafendenkmals tagumlandnbsp ob obstvergessen wir habennaturpark niederlausitzerhier lsstentdeckenquoterste sternenparklecker vondie sommerlichenausesel durch denmal wiederhaushuckleberrylandlust auslebenoffenen denkmals auchtag oderwieder raus inskinderhier aktuellefr einenschweizeilefinden sieerleben tief durchatmenauslebentipps hier fngtbundesweiten tagfr familien kulturliebhaberlausitzerwasserdes offenenveranstaltungshhepunktebundesweiten tag dessprung ins wasserelbeelsterland lausitzerwir habenmit wildpferdenein mysterienspielprsentieren ihnen diesich ganz entspanntnah der quoterstelangohren2flmingessen ampbrandenburg bietetamp herrenhuserentspanntjahren wirdwasser entdeckenihnen ferienhuser mitzum ersten malruppiner seenlandbegleitung sanftmtiger langohrentagausflugstipps durch brandenburgaufbrechen wir habenunter demschnste zeitunteresgmbhkonzertenseenland barnimersanftmtigerheidehausbootauchden flming wanderntmbdie reizvolleoderentdecken kultur erlebenpurerlebnisseersten malber dassternenliebhaberwisente und vieleerlebentemperaturen in einemfindenbestellenferienzeitunsere empfehlungbietet 100 exklusivees sich ganzmorgensternen ganz nahdas wasser gleitenjetztim berliner umlandnbspjetzt bestellen dergenieen hierbisschen dassternenliebhaber und menschenerstenausflugsregionennach brandenburgmenschenfoto tmbfotoarchivsteffenprsentierenam wochenendeunterwegspur und einpotsdam spreewald uckermarkeinem biergarten oderamp trinkenneu1ist heimat frapp der dbeinem biergartenspreewalddie veranstaltungshhepunktebrandenburg appganzlauschenflsseniveau wir prsentierenservicesameile in begleitungauf hchstementschleunigerder blicksternedaslaienschauspielern aus derhaben ihnen tourenweitere selteneist manam morgen zusterne amdesufernufern aufbrechenbrandenburg bietet rabattewir haben diedas sindlauschen und dieherunterladen db ausflugbietet rabattebrandenburgs top orte10 restauranttipps ampflanzenartenjterboger nikolaikirche einohne hastfngtdie besten tippssternenhimmelgefhl vonschlafenaugust ist sternschnuppenzeitnachregion aufgefhrtferienzeit schnste zeitmit derohnelangohren wandertauszeiten ausflugstipps kleineob obst gemseseenland barnimer landdie sommerferien veranstaltungstippsbesonders gut schlemmenbegleitungdurchatmenaktuellewasser und amumlandnbspgemse ksewir prsentieren ihnenim ostenrestaurant am wasserprzewalskipferde wisentebrandenburg spannende historischejahrendberitzerwochenendebiergartensprungjetzt herunterladenmenschen mit behinderungsterne am abendlausitzer seenlandveranstaltungshhepunkte des sommersaufobmittenspannendesternenpark deutschlandsquotistdie reizvolle landschaftflo ahoidas gefhl vongut schlemmen dietitelganz nahfesten ausstellungenbestellen der neueumlandnbsp obein entspanntessternenparklausitzer seenland niederlausitznaturpark uckermrkische seensieherzlichzuwesthavelland isthaus am seeder db regioob obstrabatte fr 549familienpass 20172018 erschienenzu neuen ufernmorgen und dernatur aufdie veranstaltungshhepunkte desbiergarten oder restaurantder natur lauschensommers kulturfestivals destief durchatmenentspannt paddelnneuen ufernwir haben ihnenheimat frseltene tierregiolebensmittel aus dernikolaikirche ein mysterienspielhoflden im berlinerman denist sternschnuppenzeit imhoflden imzurbietetdas sind ferienbesondere urlaubsquartieresanftmtiger langohrenpensionenfamilienpass 20172018der sprung insim westhavelland isthonig hochwertige lebensmittelhonig hochwertigemal seit 500sanft ber dasneue familienpasswietrinkendahmeheideseenreizvolle landschaft deswandernelbeelsterlandins berlinerganz entspannt paddelnfr ein entspanntesoftaugewasser amman den sternenbrandenburgersielmanns naturlandschaft dberitzeraktuellmrkischegrne findenfreizeitanbietersternenpark deutschlandsquot istersten mal seitauergewhnlicher architekturkontaktdes sommers genieenbesondere dannnbspempfehlen wirgehen sieins wasserim augustnatur der sprungschlafen unterm sternenhimmelregion bietenwieder rausbundesweitendb regioort frimgenieen hier lsstraus ins grneflo ahoi floim westenflo durch brandenburgspannende historische bautensie lieben daseinen taghier fngthotelsheimatausflugstipps durchwisenteurlaubsquartiereden sternenentspannt paddeln ganzfr przewalskipferde wisentesternschnuppenzeit im augustfamilienpassbietenaktivihnen tourendas besondere dannnbspempfehlenbarrierefreieoderspreeherrenhuser100 exklusivesternschnuppenzeit imim sdenbiosphrenreservat spreewaldhaus amausflug appdem eselsie mitkulturliebhaberist man dender jterboger nikolaikirchejetzt herunterladen dbwasser 10app jetzt herunterladenflo durchruppiner seenland barnimerweiterewir prsentierenvon huckleberry finnaugust istx hieramp pensionenrabatteveranstaltungstipps fr dieoder restaurant ammalbarnimerdurch diewesthavellandleckeram seeaktuell unsereherunterladenkleinedurch denfinden sie hiermal seitsanft bererleben tiefquotmachtostenodertalblick in dieesel durch500 jahrenkulturfestivalsaus der regionpaddeln ganz entspanntoffenen denkmalsfamilien kulturliebhaber entschleunigersommerferien veranstaltungstipps frdemhavelden flmingnationalpark unteres odertalam wasserseenland oderspreelos in brandenburgmysterienspielam abendtipps zu konzertendberitzer heide istbieten die hofldenreizvolle landschaftunterm sternenhimmel schlafenbadtemperaturenbiosphrenreservatsich ganzenglishregio nordostbieten dieseenland niederlausitzvondie bestenwoche neuausflug app jetztlosprignitzauf demausflugstipps kleine auszeitenist heimatfr familienbisschenhastexklusiveschlaubetaltourensommerferien in brandenburguckermrkischetouren frtmbfotoarchivsteffen lehmannfngt der urlaubtitel quotmachtsommers genieenobst gemsepotsdamfinnferienwohnungen amp ferienhuserbrandenburgneu finden sieaugustkulturfestivals desder naturmit dem floentspannteszeit tippsfngt dererlebnisreiche sommerferiensaarowfr einausflge mitihnen ferienhuserniveau wirvideo

Longtail Keyword Density for Reiseland-brandenburg.de

KeywordsOccurences
tag des offenen8
finden sie hier8
des offenen denkmals8
top orte im8
aus der region7
der natur auf6
naturlandschaft dberitzer heide6
willkommen in brandenburg6
sielmanns naturlandschaft dberitzer6
mit dem flo6
fr die sommerferien5
veranstaltungstipps fr die5
ber das wasser5
foto tmb-fotoarchivsteffen lehmann5
raus ins grne4
ins grne finden4
ist heimat fr4
im berliner umlandnbsp4
auge in auge4
dberitzer heide ist4
wieder raus ins4
heide ist heimat4
auge mit wildpferden4
heimat fr przewalski-pferde4
viele weitere seltene4
eile in begleitung4
hast und eile4
am wochenende mal4
begleitung sanftmtiger langohren4
sanftmtiger langohren wandert4
es sich ganz4
wandert es sich4
langohren wandert es4
wochenende mal wieder4
den flming wandern4
weitere seltene tier-4
hoflden im berliner4
wisente und viele4
mal wieder raus4
mit dem esel4
durch den flming4
esel durch den4
dem esel durch4
fr przewalski-pferde wisente4
hochwertige lebensmittel aus4
der sprung ins4
natur der sprung4
sprung ins wasser4
ins wasser am4
morgen und der4
wasser am morgen4
der natur der4
mitten in der4
sie hier aktuelle4
schlafen unterm sternenhimmel4
campingurlaub in brandenburg4
brandenburg das sind4
sind ferien mitten4
das sind ferien4
blick in die4
die sterne am4
sich ganz entspannt4
honig hochwertige lebensmittel4
lebensmittel aus der4
der region bieten4
bieten die hoflden4
region bieten die4
oder honig hochwertige4
kse oder honig4
hier und lecker4
grne finden sie4
ob obst gemse4
obst gemse kse4
gemse kse oder4
die hoflden im4
reizvolle landschaft des4
brandenburg bietet rabatte4
app jetzt herunterladen4
ausflug app jetzt4
familienpass brandenburg bietet4
die neue app4
app der db4
neue app der4
db ausflug app4
bietet rabatte fr4
wir haben ihnen4
vergessen wir haben4
haben ihnen touren4
ihnen touren fr4
fr ein entspanntes4
touren fr ein4
der db regio4
db regio nordost4
tipps und ideen4
schnste zeit tipps4
ferienzeit schnste zeit4
ideen fr erlebnisreiche4
fr erlebnisreiche sommerferien4
familienpass 20172018 erschienen4
jetzt bestellen der4
bestellen der neue4
der neue familienpass4
nordost bietet 1004
regio nordost bietet4
bietet 100 exklusive4
100 exklusive ausflugstipps4
neue familienpass brandenburg4
exklusive ausflugstipps durch4
zeit vergessen wir4
die zeit vergessen4
man den sternen4
ist man den4
westhavelland ist man4
den sternen ganz4
sternen ganz nah4
nah der quoterste4
ganz nah der4
im westhavelland ist4
ist sternschnuppenzeit im4
durch die reizvolle4
entspannt durch die4
die reizvolle landschaft4
hier aktuelle ausflugstipps4
august ist sternschnuppenzeit4
im august ist4
der quoterste sternenpark4
quoterste sternenpark deutschlandsquot4
das wasser gleiten4
sanft ber das4
rabatte fr 5494
wasser gleiten der4
gleiten der natur4
lauschen und die4
der natur lauschen4
paddeln ganz entspannt4
ausflugstipps kleine auszeiten4
deutschlandsquot ist der4
sternenpark deutschlandsquot ist4
ist der perfekte4
der perfekte ort4
ort fr sternenliebhaber4
perfekte ort fr4
ganz entspannt durch4
bundesweiten tag des4
haben die besten4
wir haben die4
die besten tipps4
woche neu finden4
brandenburg jede woche4
jede woche neu4
aufbrechen wir haben4
ufern aufbrechen wir4
wasser und am4
bernachten am wasser4
am morgen zu4
morgen zu neuen4
neuen ufern aufbrechen4
zu neuen ufern4
los in brandenburg4
dem flo durch4
gefhl von huckleberry4
das gefhl von4
von huckleberry finn4
huckleberry finn fr4
fr einen tag4
finn fr einen4
bisschen das gefhl4
ein bisschen das4
durch brandenburg das4
flo durch brandenburg4
brandenburg das bedeutet4
das bedeutet abenteuer4
pur und ein4
bedeutet abenteuer pur4
gut an bernachten4
der urlaub gut4
erleben tief durchatmen4
kultur erleben tief4
tief durchatmen landlust4
durchatmen landlust ausleben4
ruppiner seenland barnimer4
potsdam spreewald uckermark4
entdecken kultur erleben4
wasser entdecken kultur4
brandenburg fr familien4
essen amp trinken4
fr familien kulturliebhaber4
familien kulturliebhaber entschleuniger4
menschen mit behinderung4
kulturliebhaber entschleuniger naturgenieer4
seenland barnimer land4
elbe-elster-land lausitzer seenland4
haus am see4
ein haus am4
sie hier tipps4
neu finden sie4
fngt der urlaub4
hier fngt der4
hier tipps zu4
500 jahre reformation4
tipps zu konzerten4
lausitzer seenland niederlausitz4
hotels amp pensionen4
amp pensionen ferienwohnungen4
ferienwohnungen amp ferienhuser4
pensionen ferienwohnungen amp4
10 restauranttipps am4
einen tag oder4
sommers genieen sie4
des sommers genieen4
sie lieben das4
genieen sie kultur4
kultur in der4
auf hchstem niveau4
natur auf hchstem4
kulturfestivals des sommers4
lieben das besondere4
restauranttipps am wasser4
jterboger nikolaikirche ein4
ein mysterienspiel mit4
mysterienspiel mit laienschauspielern4
das besondere dannnbspempfehlen4
besondere dannnbspempfehlen wir4
hchstem niveau wir4
niveau wir prsentieren4
prachtquot ffnen zum4
quotmacht und prachtquot4
ffnen zum bundesweiten4
zum bundesweiten tag4
auch in brandenburg4
offenen denkmals auch4
dem titel quotmacht4
unter dem titel4
prsentieren ihnen die4
wir prsentieren ihnen4
ihnen die veranstaltungshhepunkte4
die veranstaltungshhepunkte des4
unsere empfehlung besondere4
veranstaltungshhepunkte des sommers4
der jterboger nikolaikirche4
nikolaikirche ein mysterienspiel4
wasser genieen hier4
am wasser genieen4
wird in der4
genieen hier lsst4
hier lsst es4
restaurant am wasser4
oder restaurant am4
temperaturen in einem4
die sommerlichen temperaturen4
einem biergarten oder4
immer aktuell unsere4
biergarten oder restaurant4
lsst es sich4
es sich besonders4
ersten mal seit4
zum ersten mal4
mal seit 5004
seit 500 jahren4
500 jahren wird4
dannnbspempfehlen wir ihnen4
wir ihnen ferienhuser4
ihnen ferienhuser mit4
besonders gut schlemmen4
sich besonders gut4
ausflugstipps ins berliner3
mit auergewhnlicher architektur3
aktuelle ausflugstipps ins3
aktuell unsere veranstaltungstipps3
erschienen familienpass 201720183
auszeiten ausflugstipps kleine3
zu konzerten festen3
empfehlung besondere urlaubsquartiere3
fr 549 freizeitanbieter3
ferienhuser mit auergewhnlicher3
konzerten festen ausstellungen3
kleine auszeiten ausflugstipps3
ins berliner umlandnbsp3
lecker von hier3
jterboger mysterienspiel jterboger3
mysterienspiel jterboger mysterienspiel3
schlemmen die sommerlichen3
gut schlemmen die3
wasser 10 restauranttipps3
mit laienschauspielern aus3
laienschauspielern aus der3
offenen denkmals tag3
sommers kulturfestivals des3
des sommers kulturfestivals3
der region aufgefhrt3
am wasser 103
tag oder mehr3
brandenburg mehr erfahren3
naturpark uckermrkische seen3
nationalpark unteres odertal3
brandenburgs top orte3
am see ein3
see ein haus3
ahoi flo ahoi3
flo ahoi flo3
tipps hier fngt3
besten tipps hier3
denkmals tag des3
brandenburg spannende historische3
entspannt paddeln ganz3
ein entspanntes paddelerlebnis3
ganz entspannt paddeln3
sternenliebhaber und menschen3
sternschnuppenzeit im august3
jetzt herunterladen db3
herunterladen db ausflug3
sommerferien in brandenburg3
sommerferien veranstaltungstipps fr3
die sommerferien veranstaltungstipps3
ausflugstipps durch brandenburg3
landschaft des flmings3
wandern mit dem3
sternenhimmel schlafen unterm3
unterm sternenhimmel schlafen3
historische bauten ihre3
spannende historische bauten3
sterne am abend3
berliner umlandnbsp ob3
flming wandern mit3
tier- und pflanzenarten3
mit wildpferden auge3
umlandnbsp ob obst3
20172018 erschienen familienpass3
mehr erfahren24
der natur16
am wasser14
mit dem14
finden sie9
sielmanns naturlandschaft9
durch brandenburg9
wir haben8
am morgen8
es sich8
ausflugsregionen im8
brandenburg das8
lausitzer seenland8
des sommers8
orte im8
sie hier8
des offenen8
tag des8
offenen denkmals8
top orte8
ganz entspannt8
durch die7
berliner umlandnbsp7
aus der7
der region7
naturlandschaft dberitzer6
dem flo6
das wasser6
bieten die6
natur auf6
dberitzer heide6
veranstaltungshhepunkte des6
oft gesucht6
menschen mit6
barnimer land5
landlust ausleben5
die sommerferien5
ganz nah5
fr die5
veranstaltungstipps fr5
besondere urlaubsquartiere5
kultur erleben5
sprung ins5
ber das5
wasser entdecken5
foto tmb-fotoarchivsteffen5
tmb-fotoarchivsteffen lehmann5
uckermrkische seen5
tief durchatmen5
landschaft des4
die reizvolle4
reizvolle landschaft4
sich ganz4
langohren wandert4
wasser am4
wandert es4
der sprung4
ins wasser4
entspannt durch4
sternschnuppenzeit im4
quoterste sternenpark4
ferien mitten4
der quoterste4
nah der4
sternenpark deutschlandsquot4
deutschlandsquot ist4
perfekte ort4
der perfekte4
ist der4
sternen ganz4
den sternen4
der blick4
ist sternschnuppenzeit4
august ist4
im westhavelland4
natur der4
man den4
ist man4
westhavelland ist4
im august4
von hier4
honig hochwertige4
heimat fr4
ist heimat4
fr przewalski-pferde4
przewalski-pferde wisente4
oder honig4
viele weitere4
hochwertige lebensmittel4
heide ist4
die hoflden4
lebensmittel aus4
hoflden im4
im berliner4
mit wildpferden4
auge mit4
kse oder4
weitere seltene4
ohne hast4
flming wandern4
den flming4
region bieten4
begleitung sanftmtiger4
sterne am4
sanftmtiger langohren4
ob obst4
obst gemse4
seltene tier-4
ort fr4
gemse kse4
dem esel4
durch den4
esel durch4
die sterne4
app jetzt4
raus ins4
wieder raus4
mal wieder4
ins grne4
grne finden4
unsere empfehlung4
aktuelle ausflugstipps4
hier aktuelle4
wochenende mal4
am wochenende4
brandenburg bietet4
familienpass brandenburg4
neue familienpass4
bietet rabatte4
rabatte fr4
kleine auszeiten4
ausflugstipps kleine4
fr 5494
empfehlung besondere4
sie lieben4
jede woche4
brandenburg jede4
ist los4
woche neu4
neu finden4
zu konzerten4
tipps zu4
hier tipps4
aktuell unsere4
immer aktuell4
besondere dannnbspempfehlen4
das besondere4
lieben das4
dannnbspempfehlen wir4
wir ihnen4
ferienhuser mit4
ihnen ferienhuser4
der neue4
bestellen der4
ein entspanntes4
fr ein4
touren fr4
db ausflug4
ausflug app4
die neue4
jetzt herunterladen4
sind ferien4
ihnen touren4
haben ihnen4
wasser gleiten4
sanft ber4
paddeln ganz4
gleiten der4
natur lauschen4
vergessen wir4
zeit vergessen4
die zeit4
neue app4
app der4
ideen fr4
zeit tipps4
schnste zeit4
fr erlebnisreiche4
erlebnisreiche sommerferien4
jetzt bestellen4
20172018 erschienen4
familienpass 201720184
ferienzeit schnste4
ausflugstipps durch4
regio nordost4
db regio4
der db4
nordost bietet4
bietet 1004
exklusive ausflugstipps4
100 exklusive4
fr sternenliebhaber4
zum bundesweiten4
morgen zu4
bernachten am4
urlaub gut4
zu neuen4
neuen ufern4
aufbrechen wir4
ufern aufbrechen4
der urlaub4
fngt der4
herzlich willkommen4
kontakt amp4
jahre reformation4
ein haus4
haus am4
hier fngt4
am see4
haben die4
die besten4
von huckleberry4
gefhl von4
das gefhl4
huckleberry finn4
finn fr4
einen tag4
fr einen4
bisschen das4
ein bisschen4
flo ahoi4
besten tipps4
das sind4
das bedeutet4
abenteuer pur4
bedeutet abenteuer4
500 jahre4
bad saarow4
durchatmen landlust4
erleben tief4
entdecken kultur4
potsdam spreewald4
spreewald uckermark4
ruppiner seenland4
seenland oder-spree4
mit behinderung4
entschleuniger naturgenieer4
amp trinken4
essen amp4
brandenburg fr4
fr familien4
kulturliebhaber entschleuniger4
familien kulturliebhaber4
seenland barnimer4
elbe-elster-land lausitzer4
amp pensionen4
hotels amp4
naturpark niederlausitzer4
pensionen ferienwohnungen4
ferienwohnungen amp4
nach brandenburg4
amp ferienhuser4
mrkische schweiz4
unteres odertal4
amp herrenhuser4
seenland niederlausitz4
im sden4
im norden4
im osten4
im westen4
tag oder4
flo durch4
sommers genieen4
mit laienschauspielern4
genieen sie4
sie kultur4
hchstem niveau4
auf hchstem4
mysterienspiel mit4
ein mysterienspiel4
500 jahren4
seit 5004
jahren wird4
der jterboger4
nikolaikirche ein4
jterboger nikolaikirche4
niveau wir4
wir prsentieren4
aktiv amp4
ffnen zum4
bundesweiten tag4
denkmals auch4
unterm sternenhimmel4
schlafen unterm4
prachtquot ffnen4
titel quotmacht4
ihnen die4
prsentieren ihnen4
die veranstaltungshhepunkte4
unter dem4
dem titel4
mal seit4
kulturfestivals des4
oder restaurant4
gut schlemmen4
restauranttipps am4
lsst es4
biergarten oder4
genieen hier4
sommerlichen temperaturen4
die sommerlichen4
sich besonders4
einem biergarten4
besonders gut4
restaurant am4
ersten mal4
jterboger mysterienspiel4
zum ersten4
hier lsst4
10 restauranttipps4
wasser genieen4
des flmings3
ausflugstipps ins3
ins berliner3
entspannt paddeln3
denkmals tag3
brandenburgs top3
auergewhnlicher architektur3
auf dem3
bauten ihre3
sternenhimmel schlafen3
konzerten festen3
x hier3
festen ausstellungen3
historische bauten3
spannende historische3
wasser 103
mit auergewhnlicher3
am abend3
unsere veranstaltungstipps3
brandenburg spannende3
lecker von3
umlandnbsp ob3
brandenburg app3
mit der3
schlemmen die3
laienschauspielern aus3
erschienen familienpass3
region aufgefhrt3
entspanntes paddelerlebnis3
brandenburg mehr3
see ein3
herunterladen db3
mysterienspiel jterboger3
sie mit3
sommerferien veranstaltungstipps3
gehen sie3
oder mehr3
ausflge mit3
hoher flming3
auszeiten ausflugstipps3
naturpark uckermrkische3
wandern mit3
ahoi flo3
biosphrenreservat spreewald3
niederlausitzer landrcken3
549 freizeitanbieter3
sommers kulturfestivals3
barrierefreie unterknfte3
wildpferden auge3
tipps hier3
niederlausitzer heidelandschaft3
nationalpark unteres3
amp78
der67
brandenburg62
die50
mit42
fr40
am36
im33
mehr31
sie30
wasser30
das26
hier24
erfahren24
des24
dem23
naturpark23
oder23
ist23
foto23
natur21
wir20
durch20
ein19
ausflugstipps16
seenland16
veranstaltungstipps16
auf15
ausflge14
kultur14
ganz14
unsere13
zu13
tipps13
ihnen13
tag12
flo12
orte12
ins12
flming12
app11
den11
brandenburgs11
entspannt10
gut10
von10
besondere10
spreewald10
ausflugsregionen10
familienpass10
mal10
bad9
zum9
naturlandschaft9
sich9
neuen9
land9
finden9
sommerferien9
jetzt9
urlaub9
sielmanns9
unterknfte9
hoflden9
morgen8
bietet8
landschaft8
ber8
westhavelland8
ferienhuser8
berliner8
weitere8
jterboger8
08
denkmals8
historische8
offenen8
lausitzer8
auge8
neue8
potsdam8
db8
zeit8
top8
sommers8
aus8
mysterienspiel8
es8
genieen8
haben8
menschen7
reformation7
auch7
seen7
heide7
biosphrenreservat7
umlandnbsp7
region7
ohne6
veranstaltungshhepunkte6
bieten6
perfekte6
wochenende6
woche6
entdecken6
nah6
wandern6
oft6
lehmann6
ruppiner6
dberitzer6
durchatmen6
gesucht6
tief6
willkommen6
niederlausitzer6
kleine6
flusslandschaft6
einem6
wird6
brandenburger5
los5
paddeln5
sprung5
ob5
sternenhimmel5
tmb-fotoarchivsteffen5
przewalski-pferde5
herunterladen5
ihre5
raus5
ffnen5
bestellen5
landlust5
see5
blick5
aktiv5
man5
urlaubsquartiere5
uckermrkische5
erleben5
unterwegs5
barnimer5
ausleben5
sterne4
schnste4
mitten4
ferien4
kanu4
campingurlaub4
sind4
lecker4
obst4
niederlausitz4
elbe-elster-land4
dahme-seenland4
lebensmittel4
hochwertige4
gemse4
kse4
honig4
unterm4
schlafen4
kulturfestivals4
theater4
hchstem4
erlebnisreiche4
konzerten4
nikolaikirche4
laienschauspielern4
sden4
nordost4
niveau4
prachtquot4
bundesweiten4
ideen4
quotmacht4
titel4
prsentieren4
herrenhuser4
unter4
prignitz4
wildpferden4
deutschlandsquot4
ort4
sternenliebhaber4
sternenpark4
quoterste4
august4
sternschnuppenzeit4
sternen4
sanft4
gleiten4
14
uckermark4
erlebnisse4
entspanntes4
touren4
lauschen4
oder-spree4
vergessen4
exklusive4
reizvolle4
seltene4
tier-4
ferienzeit4
viele4
wisente4
ausflug4
heimat4
jahren4
havelland4
gmbh4
sanftmtiger4
langohren4
wandert4
begleitung4
eile4
esel4
hast4
regio4
seit4
behinderung4
24
kinder-4
uns4
nach4
entschleuniger4
naturgenieer4
grne4
aktuelle4
empfehlung4
immer4
aktuell4
seenkette4
dannnbspempfehlen4
hotels4
lieben4
ferienwohnungen4
pensionen4
saarow4
jahre4
essen4
herzlich4
34
anreise4
kulturliebhaber4
trinken4
havel4
familien4
rabatte4
website4
kontaktformular4
services4
kontakt4
erschienen4
wieder4
auszeiten4
video4
schweiz4
jede4
temperaturen4
naturlandschaften4
biergarten4
sommerlichen4
restauranttipps4
einen4
neu4
44
restaurant4
brandenburgische4
westen4
norden4
ersten4
spannende4
schlemmen4
lsst4
osten4
besonders4
haus4
finn4
ufern4
aufbrechen4
huckleberry4
odertal4
bernachten4
fngt4
mrkische4
besten4
unteres4
bisschen4
gefhl4
abenteuer4
pur4
bedeutet4
ahoi4
festen3
freizeitanbieter3
ausstellungen3
architektur3
tmb3
x3
auergewhnlicher3
wie3
nuthe-nieplitz3
schlaubetal3
landrcken3
heidelandschaft3
suchen3
camping3
hoher3
dahme-heideseen3
hausboot3
english3
tauchen3
sttten3
nationalpark3
kurorte3
barrierefreie3
veranstaltungen3
aufgefhrt3
53
bauten3
abend3
flmings3
pflanzenarten3
flsse3
gehen3
zur3
prospektbestellung3
so3
kanutour3
silbermann3
paddelerlebnis3

What are the nameservers for reiseland-brandenburg.de?

Reiseland-brandenburg.de Domain Nameserver Information

HostIP AddressCountry
b.ns14.net 83.169.55.5Germany Germany
c.ns14.net 195.34.161.195Germany Germany
ns1.netzhaus.ag 80.86.2.250Germany Germany
ns2.netzhaus.ag 213.239.200.74Germany Germany

Reiseland-brandenburg.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Reiseland-brandenburg.de is a scam?