High trust score |
Reklama5.mk Website Information
Reklama5.mk has a High trust score, a Statvoo Rank of B, an Alexa Rank of 5,051, a Majestic Rank of 0, a Domain Authority of 21% and is not listed in DMOZ.
Reklama5.mk is hosted by Host Europe GmbH in North Rhine-westphalia, Hoest, Germany, 47652.
Reklama5.mk has an IP Address of 37.61.200.238 and a hostname of top.reklama5.mk and runs Microsoft-IIS/8.5 web server.
The domain reklama5.mk was registered 201 decades 9 years 1 week ago by , it was last modified 201 decades 9 years 1 week ago and currently is set to expire 201 decades 9 years 1 week ago.
Whois information for reklama5.mk
Full Whois Lookup for Reklama5.mk Whois Lookup
% This is the RIPE Database query service.
% The objects are in RPSL format.
%
% The RIPE Database is subject to Terms and Conditions.
% See http://www.ripe.net/db/support/db-terms-conditions.pdf
% Note: this output has been filtered.
% To receive output for a database update, use the "-B" flag.
%ERROR:101: no entries found
%
% No entries found in source RIPE.
% This query was served by the RIPE Database Query Service version 1.89.2 (HEREFORD)
Who hosts Reklama5.mk?
Reklama5.mk Web Server Information
| Hosted IP Address: | 37.61.200.238 |
| Hosted Hostname: | top.reklama5.mk |
| Service Provider: | Host Europe GmbH |
| Hosted Country: |  DE |
| Location Latitude: | 51.65 |
| Location Longitude: | 6.1833 |
| Webserver Software: | Microsoft-IIS/8.5 |
HTTP Header Analysis for Reklama5.mk
| Http-Version: | 1.1 |
| Status-Code: | 200 |
| Status: | 200 OK |
| Cache-Control: | private |
| Content-Type: | text/html; charset=utf-8 |
| Content-Encoding: | gzip |
| Vary: | Accept-Encoding |
| Server: | Microsoft-IIS/8.5 |
| X-AspNetMvc-Version: | 5.2 |
| X-AspNet-Version: | 4.0.30319 |
| X-Powered-By: | ASP.NET |
| Date: | Thu, 11 Feb 2016 12:32:33 GMT |
| Content-Length: | 33862 |
Need to find out who hosts Reklama5.mk?
Reklama5.mk Free SEO Report
Website Inpage Analysis for Reklama5.mk
| H1 Headings: | 0 | ||
| H2 Headings: | 0 | ||
| H3 Headings: | 0 | ||
| H4 Headings: | 0 | ||
| H5 Headings: | 0 | ||
| H6 Headings: | 0 | ||
| Total IFRAMEs: | 0 | ||
| Total Images: | 0 | ||
| Google Adsense: | Not Applicable | ||
| Google Analytics: | Not Applicable |
Keyword Cloud for Reklama5.mk
0 opacity24999 opacity 0webkitanimationtimingfunction linear 1000 131 0position absoluteanimationpreserve3dlinear 7495 opacity0 mozanimationtimingfunctionopacity 00px left 0px1 webkitanimationtimingfunction linearlinear 1000s infinite normalnormal forwards webkitanimationinfinitemozanimationkeyframesmozkeyframesgwdgen12r1gwdanimationgwdkeyframes 0 opacity0px width65infinite normal forwardsmatrix3d1 0120pxlinear 0s infinitelinear 0sgwdgen9m16gwdanimationgwdkeyframes 0 opacitymozanimationtimingfunction0px lefttranslatez0px120px opacity 10s infiniteheightlinear mozanimationtimingfunction lineartop960px height960px height 120pxfunctioneventlinear 2491 opacitynormalleft 0px width4995 opacity 1opacity 1 webkitanimationtimingfunction2491 opacity 1page1gwdplayanimation0 animationtimingfunction linearforwards0 1 010s linear0 webkitanimationtimingfunction linearnormal forwardswidth 960px height10s linear 0stop 0px leftmozanimationtimingfunction linear webkitkeyframes0 mozanimationtimingfunction lineargwdgen9m16gwdanimationgwdkeyframesposition2491 opacity1400pxwebkitanimationtimingfunction linear mozkeyframes960pxanimationtimingfunction linear webkitanimationtimingfunctionheight 120px opacity120px opacitylinear 4995 opacitylinear 7501falsewidthmatrix3d1 0 01linear 7495linear page1gwdplayanimationeventwidth 960pxgwdgen9m16gwdanimationgwdkeyframes 10s linearmozanimationtimingfunction linearlinear 7501 opacitywebkitanimationforwards webkitanimation100 opacitylinear 49990 0 10 webkitanimationtimingfunctiongwdgen9m16gwdanimationgwdkeyframes 0position absolute topleft 0pxlinear 24910px width 960pxlinear 100 opacity4animationtimingfunction linearlinear mozanimationtimingfunctiontop 0pxlinearfunctionad7501 opacity7495 opacitylinear 24991 mozanimationtimingfunctionlinear 4999 opacity0pxgwdgen12r1gwdanimationgwdkeyframesgwdgenchdqgwdanimationgwdkeyframes 04999 opacitygwdgen12r1gwdanimationgwdkeyframes 0linear 2499 opacitygwdgenchdqgwdanimationgwdkeyframes 0 opacity0infinite normalgwdgen9m16gwdanimationgwdkeyframes 10sabsolutebeenopacity 17495 opacity 1gwdgenchdqgwdanimationgwdkeyframes 10s linear7gwdgenchdqgwdanimationgwdkeyframes 10s0 opacity 10 02499 opacity 0opacitywebkitanimationtimingfunctiongwdgen12r1gwdanimationgwdkeyframes 10smozanimationtimingfunction linear 100linear webkitanimationtimingfunction linearwebkitanimationtimingfunction linearforwards mozanimationopacity 0 mozanimationtimingfunctionlinear webkitanimationtimingfunction0sabsolute top 0px0 0 0absolute top1 mozanimationtimingfunction linearanimationtimingfunctionlinear mozkeyframesopacity 1 animationtimingfunction1 0 01 animationtimingfunction linear2499 opacitywebkitanimationtimingfunction linear mozanimationtimingfunctionlinear webkitkeyframesheight 120pxopacity 0 animationtimingfunction4995 opacitymozanimationtimingfunction linear page1gwdplayanimationnormal forwards mozanimationmatrix3d1left1 webkitanimationtimingfunction1 animationtimingfunctiongwdautogwdtaparea1action100 opacity 0opacity 1 mozanimationtimingfunction7501 opacity 0opacity 0 webkitanimationtimingfunctionhandleswebkitkeyframesgwdgen12r1gwdanimationgwdkeyframes 10s linear8gwdgenchdqgwdanimationgwdkeyframeslinear 49950 animationtimingfunction10s
Longtail Keyword Density for Reklama5.mk
| Keywords | Occurences |
|---|---|
| 0 0 0 | 18 |
| linear -moz-animation-timing-function linear | 12 |
| -webkit-animation-timing-function linear -moz-animation-timing-function | 12 |
| animation-timing-function linear -webkit-animation-timing-function | 12 |
| linear -webkit-animation-timing-function linear | 12 |
| linear 100 opacity | 9 |
| 10s linear 0s | 9 |
| infinite normal forwards | 9 |
| 0s infinite normal | 9 |
| linear 0s infinite | 9 |
| 0 opacity 1 | 9 |
| 100 opacity 0 | 9 |
| 0 0 1 | 9 |
| opacity 0 -webkit-animation-timing-function | 6 |
| 0 -webkit-animation-timing-function linear | 6 |
| 1 -webkit-animation-timing-function linear | 6 |
| -moz-animation-timing-function linear 100 | 6 |
| 0 animation-timing-function linear | 6 |
| opacity 1 -moz-animation-timing-function | 6 |
| opacity 1 -webkit-animation-timing-function | 6 |
| 1 -moz-animation-timing-function linear | 6 |
| 1 0 0 | 6 |
| 0 1 0 | 6 |
| width 960px height | 6 |
| 0 -moz-animation-timing-function linear | 6 |
| opacity 0 -moz-animation-timing-function | 6 |
| opacity 0 animation-timing-function | 6 |
| 960px height 120px | 6 |
| 1 animation-timing-function linear | 6 |
| opacity 1 animation-timing-function | 6 |
| 0px left 0px | 4 |
| position absolute top | 4 |
| 0px width 960px | 4 |
| left 0px width | 4 |
| absolute top 0px | 4 |
| top 0px left | 4 |
| linear 4995 opacity | 3 |
| gwd-gen-12r1gwdanimationgwd-keyframes 10s linear | 3 |
| 7501 opacity 0 | 3 |
| linear 7501 opacity | 3 |
| gwd-gen-chdqgwdanimationgwd-keyframes 0 opacity | 3 |
| 4995 opacity 1 | 3 |
| normal forwards -moz-animation | 3 |
| gwd-gen-12r1gwdanimationgwd-keyframes 0 opacity | 3 |
| 4999 opacity 0 | 3 |
| linear 4999 opacity | 3 |
| 7495 opacity 1 | 3 |
| linear 7495 opacity | 3 |
| gwd-gen-chdqgwdanimationgwd-keyframes 10s linear | 3 |
| -webkit-animation-timing-function linear 100 | 3 |
| linear 2491 opacity | 3 |
| 2491 opacity 1 | 3 |
| gwd-gen-9m16gwdanimationgwd-keyframes 0 opacity | 3 |
| 120px opacity 1 | 3 |
| height 120px opacity | 3 |
| linear 2499 opacity | 3 |
| 2499 opacity 0 | 3 |
| -moz-animation-timing-function linear page1gwd-play-animation | 3 |
| gwd-gen-9m16gwdanimationgwd-keyframes 10s linear | 3 |
| -webkit-animation-timing-function linear -moz-keyframes | 3 |
| -moz-animation-timing-function linear -webkit-keyframes | 3 |
| matrix3d1 0 0 | 3 |
| normal forwards -webkit-animation | 3 |
| 0 0 | 27 |
| -moz-animation-timing-function linear | 24 |
| -webkit-animation-timing-function linear | 24 |
| opacity 1 | 21 |
| opacity 0 | 18 |
| linear -moz-animation-timing-function | 12 |
| animation-timing-function linear | 12 |
| linear -webkit-animation-timing-function | 12 |
| 0 opacity | 9 |
| 100 opacity | 9 |
| linear 100 | 9 |
| 10s linear | 9 |
| 0 1 | 9 |
| normal forwards | 9 |
| infinite normal | 9 |
| 0s infinite | 9 |
| linear 0s | 9 |
| position absolute | 7 |
| 1 -moz-animation-timing-function | 6 |
| 0 -moz-animation-timing-function | 6 |
| 0 -webkit-animation-timing-function | 6 |
| 1 -webkit-animation-timing-function | 6 |
| 0 animation-timing-function | 6 |
| 960px height | 6 |
| width 960px | 6 |
| 1 0 | 6 |
| 1 animation-timing-function | 6 |
| height 120px | 6 |
| left 0px | 5 |
| top 0px | 5 |
| absolute top | 4 |
| 0px left | 4 |
| 0px width | 4 |
| 4999 opacity | 3 |
| gwd-gen-chdqgwdanimationgwd-keyframes 10s | 3 |
| 4995 opacity | 3 |
| linear 4995 | 3 |
| linear 4999 | 3 |
| linear 7495 | 3 |
| gwd-gen-12r1gwdanimationgwd-keyframes 10s | 3 |
| linear 7501 | 3 |
| 7495 opacity | 3 |
| gwd-gen-chdqgwdanimationgwd-keyframes 0 | 3 |
| 7501 opacity | 3 |
| gwd-gen-12r1gwdanimationgwd-keyframes 0 | 3 |
| linear 2499 | 3 |
| linear -moz-keyframes | 3 |
| linear page1gwd-play-animation | 3 |
| linear -webkit-keyframes | 3 |
| 120px opacity | 3 |
| gwd-gen-9m16gwdanimationgwd-keyframes 0 | 3 |
| gwd-gen-9m16gwdanimationgwd-keyframes 10s | 3 |
| linear 2491 | 3 |
| forwards -webkit-animation | 3 |
| 2491 opacity | 3 |
| matrix3d1 0 | 3 |
| 2499 opacity | 3 |
| forwards -moz-animation | 3 |
| linear | 69 |
| 0 | 64 |
| opacity | 39 |
| 1 | 30 |
| -moz-animation-timing-function | 24 |
| -webkit-animation-timing-function | 24 |
| animation-timing-function | 12 |
| 2 | 11 |
| 0px | 10 |
| 10s | 9 |
| 0s | 9 |
| forwards | 9 |
| position | 9 |
| normal | 9 |
| infinite | 9 |
| absolute | 7 |
| width | 7 |
| height | 7 |
| gwd-gen-chdqgwdanimationgwd-keyframes | 6 |
| gwd-gen-12r1gwdanimationgwd-keyframes | 6 |
| gwd-gen-9m16gwdanimationgwd-keyframes | 6 |
| false | 6 |
| 120px | 6 |
| event | 6 |
| 960px | 6 |
| left | 5 |
| ad | 5 |
| function | 5 |
| top | 5 |
| 3 | 3 |
| been | 3 |
| handles | 3 |
| 4 | 3 |
| functionevent | 3 |
| gwdautogwdtaparea1action | 3 |
| 5 | 3 |
| 6 | 3 |
| 7 | 3 |
| translatez0px | 3 |
| keyframes | 3 |
| preserve-3d | 3 |
| 1400px | 3 |
| matrix3d1 | 3 |
| 8 | 3 |
| -webkit-keyframes | 3 |
| -webkit-animation | 3 |
| animation | 3 |
| page1gwd-play-animation | 3 |
| -moz-keyframes | 3 |
| -moz-animation | 3 |
What are the nameservers for reklama5.mk?
Reklama5.mk Domain Nameserver Information
| Host | IP Address | Country | |
|---|---|---|---|
| ns1.hans.hosteurope.de |  | 217.115.143.140 | Germany |
| ns2.hans.hosteurope.de | | 80.237.128.10 | Germany |