Reklama5.mk  |  Oglasi | Reklama5.mk | ?????? | ?????????? | ?????????? | ?????????? | ?????? ???????? | ??????,?????? | ??????????? | ??????? |
High trust score  | 

Reklama5.mk Website Information

Reklama5.mk has a High trust score, a Statvoo Rank of B, an Alexa Rank of 5,051, a Majestic Rank of 0, a Domain Authority of 21% and is not listed in DMOZ.

Reklama5.mk is hosted by Host Europe GmbH in North Rhine-westphalia, Hoest, Germany, 47652.
Reklama5.mk has an IP Address of 37.61.200.238 and a hostname of top.reklama5.mk and runs Microsoft-IIS/8.5 web server.

The domain reklama5.mk was registered 201 decades 9 years 1 week ago by , it was last modified 201 decades 9 years 1 week ago and currently is set to expire 201 decades 9 years 1 week ago.


Whois information for reklama5.mk

Full Whois Lookup for Reklama5.mk Whois Lookup

% This is the RIPE Database query service.
% The objects are in RPSL format.
%
% The RIPE Database is subject to Terms and Conditions.
% See http://www.ripe.net/db/support/db-terms-conditions.pdf

% Note: this output has been filtered.
% To receive output for a database update, use the "-B" flag.

%ERROR:101: no entries found
%
% No entries found in source RIPE.

% This query was served by the RIPE Database Query Service version 1.89.2 (HEREFORD)

Who hosts Reklama5.mk?

Reklama5.mk Web Server Information

Hosted IP Address:37.61.200.238
Hosted Hostname:top.reklama5.mk
Service Provider:Host Europe GmbH
Hosted Country:GermanyDE
Location Latitude:51.65
Location Longitude:6.1833
Webserver Software:Microsoft-IIS/8.5

HTTP Header Analysis for Reklama5.mk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Vary: Accept-Encoding
Server: Microsoft-IIS/8.5
X-AspNetMvc-Version: 5.2
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Thu, 11 Feb 2016 12:32:33 GMT
Content-Length: 33862


Need to find out who hosts Reklama5.mk?

Reklama5.mk Free SEO Report

Website Inpage Analysis for Reklama5.mk

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Reklama5.mk

0 opacity24999 opacity 0webkitanimationtimingfunction linear 1000 131 0position absoluteanimationpreserve3dlinear 7495 opacity0 mozanimationtimingfunctionopacity 00px left 0px1 webkitanimationtimingfunction linearlinear 1000s infinite normalnormal forwards webkitanimationinfinitemozanimationkeyframesmozkeyframesgwdgen12r1gwdanimationgwdkeyframes 0 opacity0px width65infinite normal forwardsmatrix3d1 0120pxlinear 0s infinitelinear 0sgwdgen9m16gwdanimationgwdkeyframes 0 opacitymozanimationtimingfunction0px lefttranslatez0px120px opacity 10s infiniteheightlinear mozanimationtimingfunction lineartop960px height960px height 120pxfunctioneventlinear 2491 opacitynormalleft 0px width4995 opacity 1opacity 1 webkitanimationtimingfunction2491 opacity 1page1gwdplayanimation0 animationtimingfunction linearforwards0 1 010s linear0 webkitanimationtimingfunction linearnormal forwardswidth 960px height10s linear 0stop 0px leftmozanimationtimingfunction linear webkitkeyframes0 mozanimationtimingfunction lineargwdgen9m16gwdanimationgwdkeyframesposition2491 opacity1400pxwebkitanimationtimingfunction linear mozkeyframes960pxanimationtimingfunction linear webkitanimationtimingfunctionheight 120px opacity120px opacitylinear 4995 opacitylinear 7501falsewidthmatrix3d1 0 01linear 7495linear page1gwdplayanimationeventwidth 960pxgwdgen9m16gwdanimationgwdkeyframes 10s linearmozanimationtimingfunction linearlinear 7501 opacitywebkitanimationforwards webkitanimation100 opacitylinear 49990 0 10 webkitanimationtimingfunctiongwdgen9m16gwdanimationgwdkeyframes 0position absolute topleft 0pxlinear 24910px width 960pxlinear 100 opacity4animationtimingfunction linearlinear mozanimationtimingfunctiontop 0pxlinearfunctionad7501 opacity7495 opacitylinear 24991 mozanimationtimingfunctionlinear 4999 opacity0pxgwdgen12r1gwdanimationgwdkeyframesgwdgenchdqgwdanimationgwdkeyframes 04999 opacitygwdgen12r1gwdanimationgwdkeyframes 0linear 2499 opacitygwdgenchdqgwdanimationgwdkeyframes 0 opacity0infinite normalgwdgen9m16gwdanimationgwdkeyframes 10sabsolutebeenopacity 17495 opacity 1gwdgenchdqgwdanimationgwdkeyframes 10s linear7gwdgenchdqgwdanimationgwdkeyframes 10s0 opacity 10 02499 opacity 0opacitywebkitanimationtimingfunctiongwdgen12r1gwdanimationgwdkeyframes 10smozanimationtimingfunction linear 100linear webkitanimationtimingfunction linearwebkitanimationtimingfunction linearforwards mozanimationopacity 0 mozanimationtimingfunctionlinear webkitanimationtimingfunction0sabsolute top 0px0 0 0absolute top1 mozanimationtimingfunction linearanimationtimingfunctionlinear mozkeyframesopacity 1 animationtimingfunction1 0 01 animationtimingfunction linear2499 opacitywebkitanimationtimingfunction linear mozanimationtimingfunctionlinear webkitkeyframesheight 120pxopacity 0 animationtimingfunction4995 opacitymozanimationtimingfunction linear page1gwdplayanimationnormal forwards mozanimationmatrix3d1left1 webkitanimationtimingfunction1 animationtimingfunctiongwdautogwdtaparea1action100 opacity 0opacity 1 mozanimationtimingfunction7501 opacity 0opacity 0 webkitanimationtimingfunctionhandleswebkitkeyframesgwdgen12r1gwdanimationgwdkeyframes 10s linear8gwdgenchdqgwdanimationgwdkeyframeslinear 49950 animationtimingfunction10s

Longtail Keyword Density for Reklama5.mk

KeywordsOccurences
0 0 018
linear -moz-animation-timing-function linear12
-webkit-animation-timing-function linear -moz-animation-timing-function12
animation-timing-function linear -webkit-animation-timing-function12
linear -webkit-animation-timing-function linear12
linear 100 opacity9
10s linear 0s9
infinite normal forwards9
0s infinite normal9
linear 0s infinite9
0 opacity 19
100 opacity 09
0 0 19
opacity 0 -webkit-animation-timing-function6
0 -webkit-animation-timing-function linear6
1 -webkit-animation-timing-function linear6
-moz-animation-timing-function linear 1006
0 animation-timing-function linear6
opacity 1 -moz-animation-timing-function6
opacity 1 -webkit-animation-timing-function6
1 -moz-animation-timing-function linear6
1 0 06
0 1 06
width 960px height6
0 -moz-animation-timing-function linear6
opacity 0 -moz-animation-timing-function6
opacity 0 animation-timing-function6
960px height 120px6
1 animation-timing-function linear6
opacity 1 animation-timing-function6
0px left 0px4
position absolute top4
0px width 960px4
left 0px width4
absolute top 0px4
top 0px left4
linear 4995 opacity3
gwd-gen-12r1gwdanimationgwd-keyframes 10s linear3
7501 opacity 03
linear 7501 opacity3
gwd-gen-chdqgwdanimationgwd-keyframes 0 opacity3
4995 opacity 13
normal forwards -moz-animation3
gwd-gen-12r1gwdanimationgwd-keyframes 0 opacity3
4999 opacity 03
linear 4999 opacity3
7495 opacity 13
linear 7495 opacity3
gwd-gen-chdqgwdanimationgwd-keyframes 10s linear3
-webkit-animation-timing-function linear 1003
linear 2491 opacity3
2491 opacity 13
gwd-gen-9m16gwdanimationgwd-keyframes 0 opacity3
120px opacity 13
height 120px opacity3
linear 2499 opacity3
2499 opacity 03
-moz-animation-timing-function linear page1gwd-play-animation3
gwd-gen-9m16gwdanimationgwd-keyframes 10s linear3
-webkit-animation-timing-function linear -moz-keyframes3
-moz-animation-timing-function linear -webkit-keyframes3
matrix3d1 0 03
normal forwards -webkit-animation3
0 027
-moz-animation-timing-function linear24
-webkit-animation-timing-function linear24
opacity 121
opacity 018
linear -moz-animation-timing-function12
animation-timing-function linear12
linear -webkit-animation-timing-function12
0 opacity9
100 opacity9
linear 1009
10s linear9
0 19
normal forwards9
infinite normal9
0s infinite9
linear 0s9
position absolute7
1 -moz-animation-timing-function6
0 -moz-animation-timing-function6
0 -webkit-animation-timing-function6
1 -webkit-animation-timing-function6
0 animation-timing-function6
960px height6
width 960px6
1 06
1 animation-timing-function6
height 120px6
left 0px5
top 0px5
absolute top4
0px left4
0px width4
4999 opacity3
gwd-gen-chdqgwdanimationgwd-keyframes 10s3
4995 opacity3
linear 49953
linear 49993
linear 74953
gwd-gen-12r1gwdanimationgwd-keyframes 10s3
linear 75013
7495 opacity3
gwd-gen-chdqgwdanimationgwd-keyframes 03
7501 opacity3
gwd-gen-12r1gwdanimationgwd-keyframes 03
linear 24993
linear -moz-keyframes3
linear page1gwd-play-animation3
linear -webkit-keyframes3
120px opacity3
gwd-gen-9m16gwdanimationgwd-keyframes 03
gwd-gen-9m16gwdanimationgwd-keyframes 10s3
linear 24913
forwards -webkit-animation3
2491 opacity3
matrix3d1 03
2499 opacity3
forwards -moz-animation3
linear69
064
opacity39
130
-moz-animation-timing-function24
-webkit-animation-timing-function24
animation-timing-function12
211
0px10
10s9
0s9
forwards9
position9
normal9
infinite9
absolute7
width7
height7
gwd-gen-chdqgwdanimationgwd-keyframes6
gwd-gen-12r1gwdanimationgwd-keyframes6
gwd-gen-9m16gwdanimationgwd-keyframes6
false6
120px6
event6
960px6
left5
ad5
function5
top5
33
been3
handles3
43
functionevent3
gwdautogwdtaparea1action3
53
63
73
translatez0px3
keyframes3
preserve-3d3
1400px3
matrix3d13
83
-webkit-keyframes3
-webkit-animation3
animation3
page1gwd-play-animation3
-moz-keyframes3
-moz-animation3

What are the nameservers for reklama5.mk?

Reklama5.mk Domain Nameserver Information

HostIP AddressCountry
ns1.hans.hosteurope.de 217.115.143.140Germany Germany
ns2.hans.hosteurope.de 80.237.128.10Germany Germany

Reklama5.mk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Reklama5.mk is a scam?