Reklama5.mk  |  Oglasi | Reklama5.mk | ?????? | ?????????? | ?????????? | ?????????? | ?????? ???????? | ??????,?????? | ??????????? | ??????? |
High trust score  | 



Reklama5.mk Website Information

Website Ranks & Scores for Reklama5.mk

Statvoo Rank Statvoo Rank:B
Alexa Rank Alexa Rank:5,051
Majestic Rank Majestic Rank:0
Domain Authority Domain Authority:21%
DMOZ DMOZ Listing:No

Whois information for reklama5.mk

Full Whois Lookup for Reklama5.mk Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Reklama5.mk. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

% This is the RIPE Database query service.
% The objects are in RPSL format.
%
% The RIPE Database is subject to Terms and Conditions.
% See http://www.ripe.net/db/support/db-terms-conditions.pdf

% Note: this output has been filtered.
% To receive output for a database update, use the "-B" flag.

%ERROR:101: no entries found
%
% No entries found in source RIPE.

% This query was served by the RIPE Database Query Service version 1.89.2 (HEREFORD)

Who hosts Reklama5.mk?

Reklama5.mk is hosted by Host Europe GmbH in North Rhine-westphalia, Hoest, Germany, 47652.
Reklama5.mk has an IP Address of 37.61.200.238 and a hostname of top.reklama5.mk and runs Microsoft-IIS/8.5 web server.



Reklama5.mk Web Server Information

Hosted IP Address:37.61.200.238
Hosted Hostname:top.reklama5.mk
Service Provider:Host Europe GmbH
Hosted Country:GermanyDE
Location Latitude:51.65
Location Longitude:6.1833
Webserver Software:Microsoft-IIS/8.5
Google Map of 50,12

Websites Hosted on Same IP (i.e. 37.61.200.238)

Njoftime | Publicitet.al | Shpallje | Makina | Imobiliare |...
- publicitet.al

  892,471   $ 1,200.00

Reklama5
- reklama5.com.mk

  931,044   $ 960.00

HTTP Header Analysis for Reklama5.mk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Vary: Accept-Encoding
Server: Microsoft-IIS/8.5
X-AspNetMvc-Version: 5.2
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Thu, 11 Feb 2016 12:32:33 GMT
Content-Length: 33862


Need to find out who hosts Reklama5.mk?

Reklama5.mk Free SEO Report

Website Inpage Analysis for Reklama5.mk

H1 Headings:0
H2 Headings:0
H3 Headings:1
300271Огласи
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:6
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Reklama5.mk

2499 opacityadopacitynormal forwards mozanimation0 animationtimingfunction linear0px left 0pxopacity 1 animationtimingfunctionfunctiongwdgen12r1gwdanimationgwdkeyframes 10s lineareventlinear 7495 opacity1 webkitanimationtimingfunctioninfiniteopacity 14999 opacity 0functioneventgwdgen9m16gwdanimationgwdkeyframes 0forwards mozanimationwidth 960pxgwdgen9m16gwdanimationgwdkeyframes 10skeyframes1 0 0mozanimationtimingfunction lineartop 0px left4995 opacityopacity 0 mozanimationtimingfunctionanimationtimingfunctionwebkitanimationtimingfunction linear 100gwdgen12r1gwdanimationgwdkeyframes 0100 opacity0px width 960pxwebkitanimationtimingfunctionlinear 75010 opacitywidth960pxgwdgenchdqgwdanimationgwdkeyframes 10s linear6linear 7501 opacityabsolute top4999 opacity2491 opacitywebkitanimation1 mozanimationtimingfunction linearmozanimationtimingfunctionmatrix3d1beenmozanimationtimingfunction linear webkitkeyframeslinear page1gwdplayanimationlinear 49991gwdgen12r1gwdanimationgwdkeyframes 10sforwards webkitanimationwebkitanimationtimingfunction linear mozanimationtimingfunctionhandles0s infinitewidth 960px height1400pxgwdgen12r1gwdanimationgwdkeyframesgwdgenchdqgwdanimationgwdkeyframes 0 opacity2left 0px1 animationtimingfunction linear0 animationtimingfunctionposition absoluteopacity 1 mozanimationtimingfunctiongwdgen12r1gwdanimationgwdkeyframes 0 opacitymozanimationtimingfunction linear page1gwdplayanimation0 mozanimationtimingfunction lineargwdgenchdqgwdanimationgwdkeyframes 10slinear 4995 opacity0 webkitanimationtimingfunctionheightlinear 4995webkitanimationtimingfunction linear mozkeyframesopacity 0 animationtimingfunctiontop 0pxleftlinear 4999 opacitygwdgenchdqgwdanimationgwdkeyframes0 10pxlinear mozkeyframes1 00px widthnormal forwardsgwdgen9m16gwdanimationgwdkeyframeswebkitanimationtimingfunction linear0 1 01 mozanimationtimingfunctionpreserve3d1 webkitanimationtimingfunction linearlinear 2499mozanimationtimingfunction linear 1000 0 1120px opacity 1410sleft 0px widthlinear webkitanimationtimingfunction linearlinear mozanimationtimingfunction linear7495 opacity 10snormal forwards webkitanimation80 webkitanimationtimingfunction linear0 mozanimationtimingfunctionmatrix3d1 0 0infinite normal0 0 0120px10s linear7501 opacityopacity 0 webkitanimationtimingfunctionanimationtimingfunction linearlinear 7495topheight 120pxanimationwebkitkeyframesforwardslinear 100 opacityanimationtimingfunction linear webkitanimationtimingfunctionabsolute top 0pxposition absolute top2499 opacity 0960px height 120pxnormal960px heightlinear 2491opacity 0height 120px opacityinfinite normal forwardsgwdgen9m16gwdanimationgwdkeyframes 0 opacity120px opacitylinear webkitkeyframesgwdautogwdtaparea1actiongwdgenchdqgwdanimationgwdkeyframes 0linear mozanimationtimingfunction10s linear 0sfalseabsolute0s infinite normal3linear webkitanimationtimingfunction0linear 2491 opacitylinear 0s7495 opacitylinear 100linear 0s infinitepage1gwdplayanimation5mozanimation0 opacity 17linear2491 opacity 1gwdgen9m16gwdanimationgwdkeyframes 10s linear4995 opacity 1positionopacity 1 webkitanimationtimingfunction0px left7501 opacity 0translatez0px100 opacity 0linear 2499 opacity0 0matrix3d1 01 animationtimingfunctionmozkeyframes

Longtail Keyword Density for Reklama5.mk

KeywordsOccurences
0 0 018
linear -moz-animation-timing-function linear12
-webkit-animation-timing-function linear -moz-animation-timing-function12
animation-timing-function linear -webkit-animation-timing-function12
linear -webkit-animation-timing-function linear12
linear 100 opacity9
10s linear 0s9
infinite normal forwards9
0s infinite normal9
linear 0s infinite9
0 opacity 19
100 opacity 09
0 0 19
opacity 0 -webkit-animation-timing-function6
0 -webkit-animation-timing-function linear6
1 -webkit-animation-timing-function linear6
-moz-animation-timing-function linear 1006
0 animation-timing-function linear6
opacity 1 -moz-animation-timing-function6
opacity 1 -webkit-animation-timing-function6
1 -moz-animation-timing-function linear6
1 0 06
0 1 06
width 960px height6
0 -moz-animation-timing-function linear6
opacity 0 -moz-animation-timing-function6
opacity 0 animation-timing-function6
960px height 120px6
1 animation-timing-function linear6
opacity 1 animation-timing-function6
0px left 0px4
position absolute top4
0px width 960px4
left 0px width4
absolute top 0px4
top 0px left4
linear 4995 opacity3
gwd-gen-12r1gwdanimationgwd-keyframes 10s linear3
7501 opacity 03
linear 7501 opacity3
gwd-gen-chdqgwdanimationgwd-keyframes 0 opacity3
4995 opacity 13
normal forwards -moz-animation3
gwd-gen-12r1gwdanimationgwd-keyframes 0 opacity3
4999 opacity 03
linear 4999 opacity3
7495 opacity 13
linear 7495 opacity3
gwd-gen-chdqgwdanimationgwd-keyframes 10s linear3
-webkit-animation-timing-function linear 1003
linear 2491 opacity3
2491 opacity 13
gwd-gen-9m16gwdanimationgwd-keyframes 0 opacity3
120px opacity 13
height 120px opacity3
linear 2499 opacity3
2499 opacity 03
-moz-animation-timing-function linear page1gwd-play-animation3
gwd-gen-9m16gwdanimationgwd-keyframes 10s linear3
-webkit-animation-timing-function linear -moz-keyframes3
-moz-animation-timing-function linear -webkit-keyframes3
matrix3d1 0 03
normal forwards -webkit-animation3
0 027
-moz-animation-timing-function linear24
-webkit-animation-timing-function linear24
opacity 121
opacity 018
linear -moz-animation-timing-function12
animation-timing-function linear12
linear -webkit-animation-timing-function12
0 opacity9
100 opacity9
linear 1009
10s linear9
0 19
normal forwards9
infinite normal9
0s infinite9
linear 0s9
position absolute7
1 -moz-animation-timing-function6
0 -moz-animation-timing-function6
0 -webkit-animation-timing-function6
1 -webkit-animation-timing-function6
0 animation-timing-function6
960px height6
width 960px6
1 06
1 animation-timing-function6
height 120px6
left 0px5
top 0px5
absolute top4
0px left4
0px width4
4999 opacity3
gwd-gen-chdqgwdanimationgwd-keyframes 10s3
4995 opacity3
linear 49953
linear 49993
linear 74953
gwd-gen-12r1gwdanimationgwd-keyframes 10s3
linear 75013
7495 opacity3
gwd-gen-chdqgwdanimationgwd-keyframes 03
7501 opacity3
gwd-gen-12r1gwdanimationgwd-keyframes 03
linear 24993
linear -moz-keyframes3
linear page1gwd-play-animation3
linear -webkit-keyframes3
120px opacity3
gwd-gen-9m16gwdanimationgwd-keyframes 03
gwd-gen-9m16gwdanimationgwd-keyframes 10s3
linear 24913
forwards -webkit-animation3
2491 opacity3
matrix3d1 03
2499 opacity3
forwards -moz-animation3
linear69
064
opacity39
130
-moz-animation-timing-function24
-webkit-animation-timing-function24
animation-timing-function12
211
0px10
10s9
0s9
forwards9
position9
normal9
infinite9
absolute7
width7
height7
gwd-gen-chdqgwdanimationgwd-keyframes6
gwd-gen-12r1gwdanimationgwd-keyframes6
gwd-gen-9m16gwdanimationgwd-keyframes6
false6
120px6
event6
960px6
left5
ad5
function5
top5
33
been3
handles3
43
functionevent3
gwdautogwdtaparea1action3
53
63
73
translatez0px3
keyframes3
preserve-3d3
1400px3
matrix3d13
83
-webkit-keyframes3
-webkit-animation3
animation3
page1gwd-play-animation3
-moz-keyframes3
-moz-animation3

What are the nameservers for reklama5.mk?

Reklama5.mk Domain Nameserver Information

HostIP AddressCountry
ns1.hans.hosteurope.de 217.115.143.140Germany Germany
ns2.hans.hosteurope.de 80.237.128.10Germany Germany

Reklama5.mk DNS Record Analysis DNS Lookup

HostTypeTTLExtra
reklama5.mkA86392IP: 37.61.200.238
reklama5.mkNS259200Target: ns1.hans.hosteurope.de
reklama5.mkNS259200Target: ns2.hans.hosteurope.de
reklama5.mkSOA2560MNAME: ns1.hans.hosteurope.de
RNAME: hostmaster.reklama5.mk
Serial: 2016012507
Refresh: 16384
Retry: 2048
Expire: 1048576
reklama5.mkMX86400Priority: 1
Target: aspmx.l.google.com
reklama5.mkMX86400Priority: 5
Target: alt1.aspmx.l.google.com
reklama5.mkMX86400Priority: 5
Target: alt2.aspmx.l.google.com
reklama5.mkMX86400Priority: 10
Target: aspmx2.googlemail.com
reklama5.mkMX86400Priority: 10
Target: aspmx3.googlemail.com
reklama5.mkTXT86400TXT: v=spf1 a mx ip4:37.61.200.238/24
ip6:2a01:488:67:1000:253d:c8ee:0:1/48
include:_spf.google.com ~all

Alexa Traffic Rank for Reklama5.mk


Alexa Search Engine Traffic for Reklama5.mk









{**}