Respadd.org

RESPADD – Réseau de prévention des addictions

Safety: Low trust score
Year Founded: 2009
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-30
Category: This site has not been categorized yet

Bienvenue sur le site RESPADD - Réseau de prévention des addictions, Réseau Hôpital Sans Tabac, prévenir les pratiques addictives


Domain summary

Domain label
respadd
Domain extension
org
Domain registered:
2009-06-18
Domain updated:
2020-10-30
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is respadd.org ranked relative to other sites:

Percentage of visits to respadd.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Respadd.org registered?
A: Respadd.org was registered 11 years, 5 months, 2 weeks, 2 days, 11 hours, 13 minutes, 52 seconds ago on Thursday, June 18, 2009.
Q: When was the WHOIS for Respadd.org last updated?
A: The WHOIS entry was last updated 1 month, 5 days, 11 hours, 13 minutes, 52 seconds ago on Friday, October 30, 2020.
Q: What are Respadd.org's nameservers?
A: DNS for Respadd.org is provided by the following nameservers:
  • sdns2.ovh.net
Q: Who is the registrar for the Respadd.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Respadd.org?
A: Respadd.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Respadd.org each day?
A: Respadd.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Respadd.org resolve to?
A: Respadd.org resolves to the IPv4 address 51.254.126.156.
Q: In what country are Respadd.org servers located in?
A: Respadd.org has servers located in the France.
Q: What webserver software does Respadd.org use?
A: Respadd.org is powered by Nginx webserver.
Q: Who hosts Respadd.org?
A: Respadd.org is hosted by OVH SAS in France.
Q: How much is Respadd.org worth?
A: Respadd.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Respadd.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Respadd.org Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Respadd.org

H1 Headings

0 :

H2 Headings

12 :
  1. Publications récentes
  2. Informations Santé
  3. NOS THÉMATIQUES
  4. Adolescence & Addictions
  5. Repérage et auto-évaluation
  6. Réduction des risques
  7. Pharmaciens et addictions
  8. Lieu de Santé Sans Tabac
  9. Promotion de la santé
  10. ADHÉRER AU RESPADD
  11. LE RESPADD
  12. NOS COORDONNÉES

H3 Headings

12 :
  1. ACCÈS RAPIDE
  2. ACCÈS RAPIDE
  3. #MoisSansTabac 2020
  4. Annulation et digitalisation du Colloque Normandie Lieu de santé sans tabac
  5. Report et nouvelles dates pour les 25ES Rencontres du RESPADD : Des drogues en santé mentale
  6. Livret : Accompagner la réduction de la consommation d’alcool
  7. Revue Numéro 4 LSPS
  8. Agir Addictions n°10 – Juin 2020
  9. Colloque Lieu de santé promoteur de santé 2020
  10. Affiche : “La VAPE : ce qu’il faut savoir”
  11. SUIVEZ LE RESPADD
  12. S'INSCRIRE À LA NEWSLETTER

H4 Headings

0 :

H5 Headings

7 :
  1. #MoisSansTabac 2020
  2. Annulation et digitalisation du Colloque Normandie Lieu de santé sans tabac
  3. Report et nouvelles dates pour les 25ES Rencontres du RESPADD : Des drogues en santé mentale
  4. Livret : Accompagner la réduction de la consommation d’alcool
  5. Colloque Lieu de santé promoteur de santé 2020
  6. Hépatite C : renouvellement des stratégies en CAARUD et CSAPA
  7. CHEMSEX

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

16 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-12725908-1

Links - Internal

83:
  1. https://www.respadd.org/
    https://www.respadd.org/
  2. Respadd Le Réseau
    https://www.respadd.org/respadd/qui-sommes-nous/
  3. Respadd Actualités
    https://www.respadd.org/actualites/
  4. Respadd Actualités Internationales
    https://www.respadd.org/le-respadd/actualites-internationales/
  5. Respadd Actualités Nationales
    https://www.respadd.org/le-respadd/actualites-nationales/
  6. Respadd Qui sommes nous ?
    https://www.respadd.org/qui-sommes-nous/
  7. Respadd Formations du Respadd
    https://www.respadd.org/formations-du-respadd/
  8. Respadd Nos Formations
    https://www.respadd.org/formations-du-respadd/
  9. Respadd Audit et conseil
    https://www.respadd.org/formations-du-respadd/audit-et-conseil/
  10. Respadd Nos engagements
    https://www.respadd.org/formations-du-respadd/nos-engagements/
  11. Respadd Modalités des formations
    https://www.respadd.org/formations-du-respadd/modalites-des-formations/
  12. Respadd Organisation
    https://www.respadd.org/organisation/
  13. Respadd Annuaire des adhérents
    https://www.respadd.org/annuaire-des-adherents/
  14. Respadd Présence en Régions
    https://www.respadd.org/presence-en-regions/
  15. Respadd Réseaux et partenaires
    https://www.respadd.org/reseaux-et-partenaires/
  16. Respadd Rejoindre le Réseau
    https://www.respadd.org/devenir-adherent/
  17. Respadd Publications
    https://www.respadd.org/le-respadd/publications/
  18. Respadd La lettre du Respadd
    https://www.respadd.org/publications/la-lettre-du-respadd/
  19. Respadd Agir Addictions
    https://www.respadd.org/le-respadd/publications/agir-addictions/
  20. Respadd Veille Bibliographique
    https://www.respadd.org/publications/veille-bibliographique/
  21. Respadd Revue LSPS
    https://www.respadd.org/le-respadd/publications/revue-lieu-de-sante-promoteur-de-sante/
  22. Respadd Textes officiels
    https://www.respadd.org/publications/textes-officiels/
  23. Respadd Bibliographie sélective
    https://www.respadd.org/publications/bibliographie-selective/
  24. Respadd Recherche et évaluations
    https://www.respadd.org/publications/programmes-de-recherche-et-evaluations/
  25. Respadd Lieu de santé sans Tabac
    https://www.respadd.org/le-respadd/lieu-de-sante-sans-tabac/
  26. Respadd Historique
    https://www.respadd.org/hopital-sans-tabac-lieu-de-sante-sans-tabac/historique/
  27. Respadd Stratégie et Objectifs
    https://www.respadd.org/hopital-sans-tabac-lieu-de-sante-sans-tabac/strategie-et-objectifs/
  28. Respadd Audit LSST
    https://www.respadd.org/hopital-sans-tabac-lieu-de-sante-sans-tabac/audit-lieu-de-sante-sans-tabac/
  29. Respadd Enquête Tabagisme en blouse blanche
    https://www.respadd.org/hopital-sans-tabac-lieu-de-sante-sans-tabac/enquete-tabagisme-en-blouse-blanche/
  30. Respadd Publications et Outils
    https://www.respadd.org/hopital-sans-tabac-lieu-de-sante-sans-tabac/publications-et-outils/
  31. Respadd Formation et savoir faire : RPIB tabac
    https://www.respadd.org/hopital-sans-tabac-lieu-de-sante-sans-tabac/formation-et-savoir-faire-ib-tabac/
  32. Respadd Revue de presse
    https://www.respadd.org/hopital-sans-tabac-lieu-de-sante-sans-tabac/revue-de-presse/
  33. Respadd Promotion de la santé
    https://www.respadd.org/le-respadd/promotion-sante/
  34. Respadd Lieu de santé promoteur de santé
    https://www.respadd.org/promotion-de-la-sante/lieu-de-sante-promoteur-de-sante/
  35. Respadd Adhérer au réseau international
    https://www.respadd.org/promotion-de-la-sante/adherer-au-reseau-international-des-lieux-de-sante-promoteurs-de-sante/
  36. Respadd Ressources
    https://www.respadd.org/promotion-de-la-sante/ressources/
  37. Respadd Revue Lieu de santé promoteur de santé
    https://www.respadd.org/le-respadd/publications/revue-lieu-de-sante-promoteur-de-sante/
  38. Respadd Compétences psycho sociales
    https://www.respadd.org/promotion-de-la-sante/competences-psycho-sociales/
  39. Respadd Thématiques
    https://www.respadd.org/thematiques-respadd/
  40. Respadd Alcool
    https://www.respadd.org/alcool/
  41. Respadd Femmes et addictions
    https://www.respadd.org/femmes-et-addictions/
  42. Respadd Adolescence et Addictions
    https://www.respadd.org/adolescence-et-addictions/
  43. Respadd Pharmaciens et addictions
    https://www.respadd.org/pharmaciens-et-addictions/
  44. Respadd Repérage et autoévaluation
    https://www.respadd.org/reperage-et-autoevaluation/
  45. Respadd Auto-Évaluation en ligne
    https://www.respadd.org/reperage-et-autoevaluation/auto-evaluation-en-ligne/
  46. Respadd RPIB
    https://www.respadd.org/reperage-et-autoevaluation/rpib/
  47. Respadd Réduction des Risques
    https://www.respadd.org/reduction-des-risques/
  48. Respadd #MoisSansTabac
    https://www.respadd.org/thematiques-respadd/mois-sans-tabac/
  49. Respadd Colloques
    https://www.respadd.org/le-respadd/colloques/
  50. Respadd Agenda / Inscription
    https://www.respadd.org/le-respadd/agenda/
  51. Respadd Archives Colloques
    https://www.respadd.org/le-respadd/colloques/archives-colloques/
  52. Respadd Contactez-nous
    https://www.respadd.org/contact/
  53. Respadd Inscription adhérent
    https://www.respadd.org/devenir-adherent/inscription-adherent/
  54. Respadd Connexion
    https://www.respadd.org/connexion/
  55. https://www.respadd.org/blog/2020/09/25/moissanstabac-2020/
    https://www.respadd.org/blog/2020/09/25/moissanstabac-2020/
  56. Respadd Actualités
    https://www.respadd.org/le-respadd/actualites/
  57. Respadd Thématiques
    https://www.respadd.org/le-respadd/thematiques/
  58. Respadd #MoisSansTabac 2020
    https://www.respadd.org/blog/2020/09/25/moissanstabac-2020/
  59. https://www.respadd.org/blog/2020/09/17/annulation-et-digitalisation-du-colloque-normandie-lieu-de-sante-sans-tabac/
    https://www.respadd.org/blog/2020/09/17/annulation-et-digitalisation-du-colloque-normandie-lieu-de-sante-sans-tabac/
  60. Respadd Agenda
    https://www.respadd.org/le-respadd/agenda/
  61. Respadd Général
    https://www.respadd.org/le-respadd/general/
  62. Respadd Annulation et digitalisation du Colloque Normandie Lieu de santé sans tabac
    https://www.respadd.org/blog/2020/09/17/annulation-et-digitalisation-du-colloque-normandie-lieu-de-sante-sans-tabac/
  63. https://www.respadd.org/blog/2020/09/17/report-et-nouvelles-dates-pour-les-25es-rencontres-du-respadd-des-drogues-en-sante-mentale/
    https://www.respadd.org/blog/2020/09/17/report-et-nouvelles-dates-pour-les-25es-rencontres-du-respadd-des-drogues-en-sante-mentale/
  64. Respadd Report et nouvelles dates pour les 25ES Rencontres du RESPADD : Des drogues en santé mentale
    https://www.respadd.org/blog/2020/09/17/report-et-nouvelles-dates-pour-les-25es-rencontres-du-respadd-des-drogues-en-sante-mentale/
  65. https://www.respadd.org/blog/2020/08/03/livret-accompagner-la-reduction-de-la-consommation-dalcool/
    https://www.respadd.org/blog/2020/08/03/livret-accompagner-la-reduction-de-la-consommation-dalcool/
  66. Respadd Livret : Accompagner la réduction de la consommation d’alcool
    https://www.respadd.org/blog/2020/08/03/livret-accompagner-la-reduction-de-la-consommation-dalcool/
  67. https://www.respadd.org/blog/2020/07/06/revue-numero-4-lsps/
    https://www.respadd.org/blog/2020/07/06/revue-numero-4-lsps/
  68. Respadd Revue Numéro 4 LSPS
    https://www.respadd.org/blog/2020/07/06/revue-numero-4-lsps/
  69. https://www.respadd.org/blog/2020/06/15/agir-addictions-n10-juin-2020/
    https://www.respadd.org/blog/2020/06/15/agir-addictions-n10-juin-2020/
  70. Respadd Agir Addictions n°10 – Juin 2020
    https://www.respadd.org/blog/2020/06/15/agir-addictions-n10-juin-2020/
  71. https://www.respadd.org/blog/2020/06/10/colloque-lieu-de-sante-promoteur-de-sante-2020/
    https://www.respadd.org/blog/2020/06/10/colloque-lieu-de-sante-promoteur-de-sante-2020/
  72. Respadd Colloque Lieu de santé promoteur de santé 2020
    https://www.respadd.org/blog/2020/06/10/colloque-lieu-de-sante-promoteur-de-sante-2020/
  73. https://www.respadd.org/blog/2020/05/20/affiche-la-vape-ce-quil-faut-savoir/
    https://www.respadd.org/blog/2020/05/20/affiche-la-vape-ce-quil-faut-savoir/
  74. Respadd Affiche : “La VAPE : ce qu’il faut savoir”
    https://www.respadd.org/blog/2020/05/20/affiche-la-vape-ce-quil-faut-savoir/
  75. https://www.respadd.org/blog/2018/04/24/hepatite-c/
    https://www.respadd.org/blog/2018/04/24/hepatite-c/
  76. Respadd Hépatite C : renouvellement des stratégies en CAARUD et CSAPA
    https://www.respadd.org/blog/2018/04/24/hepatite-c/
  77. https://www.respadd.org/blog/2018/04/24/chemsex/
    https://www.respadd.org/blog/2018/04/24/chemsex/
  78. Respadd CHEMSEX
    https://www.respadd.org/blog/2018/04/24/chemsex/
  79. Respadd DEVENIR ADHÉRENT
    http://respadd.org/devenir-adherent/inscription-adherent/
  80. Respadd Contact
    https://www.respadd.org/contact/
  81. Respadd Espace presse
    https://www.respadd.org/le-respadd/espace-presse/
  82. Respadd Mentions Légales
    https://www.respadd.org/mentions-legales/
  83. Respadd Politique de confidentialité
    https://www.respadd.org/politique-de-confidentialite/

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Respadd.org

pgw5bfe50bd26fc60 panelgridcellpgw5bfe50bd26fc63plw5b8f8ad2dec76publicationspanelgridcell pgw5b8f8ad2dedcb0panelgridcell pgw5bae4ecd64c670rduction desetwidth315068plw5b8f827b45132panelgridcell pgw5b8f827b451320adolescencepgw5bae4ecd64c670panelgridcell pgw5bfe50bd26fc62 panelrowstylepgw5be412395acbb1 panelgridcelllettre du respaddpanelgridcell pgw5b8f8ad2ded5d0agirpgw5bfe50bd26fc61 panelgridcellrepragepanelgridcellemptypgw5bae4ecd64c6710panelgridcell pgw5bfe50bd26fc61 panelrowstylepgw5be412395acbb3 panelgridcell pgw5be412395acbb3padding30pxautovaluationagendamarginleft0marginright0pgw5b8f8ad2decee0pgw5bae4ecd64c672 panelgridcell pgw5bae4ecd64c672floatnonewidthautomedia maxwidth780pxpanelrowstyle panelgridcell marginbottom30pxpromotionlettrepgw5be412395acbb2 panelrowstyleformations duplw5be412395acbbplw5b8f8ad2dec76 panelgridplw5bfe50bd26fc6panelrowstyle panelgridcelllastchild marginbottom0pxpanelrowstyle padding30pxpanelgridcell pgw5bfe50bd26fc60 panelrowstylepgw5be412395acbb0paddingleft15pxpaddingright15pxsansaccsplw5be412395acbb panelgridmarginbottom0px mediasant adhrer aulieupanelgridcell pgw5be412395acbb1revuepgw5bae4ecd64c670 panelgridcellpanelrowstyle panelgridcellrisquespgw5bfe50bd26fc61 panelgridcell pgw5bfe50bd26fc61panelgridcellempty displaynonerseaupanelgridcell marginbottom30px layout0pxlepromoteur de santpanelrowstyle panelgridcelllastchildpgw5bfe50bd26fc63 panelgridcell pgw5bfe50bd26fc63padding0pgw5bfe50bd26fc62 panelgridcellpanelgridcell pgw5bae4ecd64c671panelrowstyle panelgridcell paddingleft15pxpaddingright15pxpgw5be412395acbb2padding30px 0px 0pxpgw5b8f827b451320 panelrowstyledisplaynonepgw5b8f8ad2dedcb0 panelgridcell pgw5b8f8ad2dedcb0tabacthmatiquesinscriptionplw5b8f827b45132 panelgridpanelgridcell pgw5b8f8ad2ded5d0 panelrowstylerespaddpgw5bfe50bd26fc63 panelgridcell0px 0pxsopanellastchild marginbottom0pxdesadhrer auformations du respaddwidth684932pharmaciens etsans tabacplw5bae4ecd64c67pgw5bfe50bd26fc61 panelrowstyleaddictionspanelgridcell marginbottom30pxauplw5b8f8ad2ded5d panelgridactualitsactualits0px media maxwidth780pxpanelgridcell pgw5bae4ecd64c671 panelrowstylelespanelgridcell pgw5b8f8ad2dedcb0 panelrowstylecpanelgridcell floatnonewidthautopgw5be412395acbb3pgw5bae4ecd64c670 panelgridcell pgw5bae4ecd64c670pgw5be412395acbb0 panelgridcellpgw5bfe50bd26fc60pressemoissanstabacpanelgridcell pgw5bae4ecd64c672panelgridcell pgw5bfe50bd26fc63 panelrowstylepanelgridcell pgw5be412395acbb3 panelrowstyleet addictionssant adhrerpanelgridcell pgw5be412395acbb1 panelrowstylepgw5b8f88e4c19b60sant sanspgw5b8f8ad2dedcb0 panelgridcellreprage etpanelrowstyleauditpanelgridcell pgw5b8f827b451320 panelrowstylepgw5bae4ecd64c670 panelrowstylepgw5be412395acbb3 panelrowstylerductionpanelgridcell pgw5bae4ecd64c672 panelrowstylemediapgw5be412395acbb1panelgridcell pgw5b8f88e4c19b60dupharmacienspgw5be412395acbb1 panelrowstyleresizefullimagepgw5b8f88e4c19b60 panelgridcell pgw5b8f88e4c19b60pgw5b8f8ad2dec760 panelgridcellpgw5bfe50bd26fc60 panelgridcell pgw5bfe50bd26fc60pgw5b8f8ad2ded5d0 panelgridcell2020 actualitsactualitspanelgridcell pgw5bfe50bd26fc60sant sans tabacpgw5b8f88e4c19b60 panelgridcellpanelgridcell pgw5bfe50bd26fc61lettre dupgw5b8f8ad2decee0 panelgridcell pgw5b8f8ad2decee0santpanelrowstyle padding30px 0pxmarginbottom0pxsopanelformationspgw5b8f88e4c19b60 panelrowstylecolloquepanelgridcell pgw5b8f88e4c19b60 panelrowstylepgw5b8f827b451320 panelgridcell pgw5b8f827b451320width100quipgw5be412395acbb2 panelgridcellpadding30px 0pxpanelgrid panelgridcellmobilelastpgw5b8f827b451320plw5b8f8ad2decee panelgridpanelgridpgw5b8f8ad2ded5d0 panelrowstylepgw5bae4ecd64c671 panelrowstyleplw5b8f8ad2deceedocumentwritepanelgrid panelgridcellemptypgw5be412395acbb0 panelgridcell pgw5be412395acbb0pgw5bae4ecd64c671 panelgridcell pgw5bae4ecd64c671pgw5b8f827b451320 panelgridcellpgw5b8f8ad2dedcb0 panelrowstylemarginbottom30pxpgw5bfe50bd26fc62 panelgridcell pgw5bfe50bd26fc62maxwidth780pxpanelgridcell pgw5b8f8ad2decee0 panelrowstylepanelgridcell padding0pgw5be412395acbb0 panelrowstylenospgw5bae4ecd64c672 panelgridcellmarginleft15pxmarginright15pxpgw5bfe50bd26fc63 panelrowstylepanelgridcell pgw5b8f8ad2dec760pgw5bfe50bd26fc60 panelrowstylesant promoteurpgw5b8f8ad2ded5d0panelgridcell pgw5bfe50bd26fc62pgw5b8f8ad2dedcb0panelgridcell pgw5bae4ecd64c670 panelrowstylepgw5b8f8ad2decee0 panelgridcelldocumentbodyclassnamepgw5b8f8ad2decee0 panelrowstylerpib0px 0px 0pxplw5bfe50bd26fc6 panelgridcolloques0px mediapgw5b8f8ad2dec760panelgridcell pgw5bfe50bd26fc63panelgridcell pgw5be412395acbb3pgw5bae4ecd64c672 panelrowstylemarginbottom30px layoutpanelgridcellsopanellastchild marginbottom0px mediapgw5be412395acbb3 panelgridcelldes risquesplw5b8f8ad2ded5dlayoutpanelgridcell pgw5be412395acbb2panelgridcell pgw5be412395acbb0 panelrowstylemarginbottom0px media maxwidth780pxlieu de santpanelgridcellmobilelastadhrerpgw5bae4ecd64c672plw5b8f8ad2dedcbplw5bae4ecd64c67 panelgridpanelgridcelllastchildpanelgridcell pgw5be412395acbb2 panelrowstyleplw5b8f88e4c19b6du respaddpgw5be412395acbb2 panelgridcell pgw5be412395acbb2rduction des risquesplw5b8f8ad2dedcb panelgridpharmaciens et addictionspgw5bfe50bd26fc61sopanel marginbottom30pxpanelgridcelllastchild marginbottom0pxfunctionpgw5bae4ecd64c671 panelgridcellpgw5b8f8ad2ded5d0 panelgridcell pgw5b8f8ad2ded5d0panelgridcell pgw5b8f8ad2decee0panelgrid marginleft0marginright0panelgrid panelgridcellempty displaynonepanelgridcell pgw5b8f8ad2dec760 panelrowstylepgw5be412395acbb1 panelgridcell pgw5be412395acbb1plw5b8f88e4c19b6 panelgridactualitspgw5bfe50bd26fc62 panelrowstylepanelgridcell paddingleft15pxpaddingright15pxle rseaupgw5bfe50bd26fc62lspspromoteurpgw5b8f8ad2dec760 panelgridcell pgw5b8f8ad2dec760sopanellastchildpgw5b8f8ad2dec760 panelrowstyleagir addictionspanelgridcell pgw5be412395acbb0

Longtail Keyword Density for Respadd.org

KeywordsOccurences
lieu de sant13
panel-row-style panel-grid-cell padding-left15pxpadding-right15px9
panel-row-style panel-grid-cell margin-bottom30px9
panel-row-style panel-grid-celllast-child margin-bottom0px9
panel-grid panel-grid-cell-empty displaynone9
panel-grid-cell margin-bottom30px layout8
sant sans tabac7
promoteur de sant7
so-panellast-child margin-bottom0px media6
margin-bottom0px media max-width780px6
0px 0px 0px4
panel-row-style padding30px 0px4
panel-grid-cell pg-w5b8f88e4c19b6-0 panel-row-style3
panel-grid-cell pg-w5be412395acbb-2 panel-row-style3
pg-w5be412395acbb-3 panel-grid-cell pg-w5be412395acbb-33
pg-w5b8f8ad2decee-0 panel-grid-cell pg-w5b8f8ad2decee-03
panel-grid-cell pg-w5b8f8ad2decee-0 panel-row-style3
pg-w5b8f8ad2ded5d-0 panel-grid-cell pg-w5b8f8ad2ded5d-03
panel-grid-cell pg-w5b8f8ad2ded5d-0 panel-row-style3
pg-w5b8f8ad2dedcb-0 panel-grid-cell pg-w5b8f8ad2dedcb-03
panel-grid-cell pg-w5b8f8ad2dedcb-0 panel-row-style3
pg-w5be412395acbb-2 panel-grid-cell pg-w5be412395acbb-23
pg-w5b8f88e4c19b6-0 panel-grid-cell pg-w5b8f88e4c19b6-03
panel-grid-cell pg-w5be412395acbb-1 panel-row-style3
pg-w5be412395acbb-1 panel-grid-cell pg-w5be412395acbb-13
pg-w5b8f827b45132-0 panel-grid-cell pg-w5b8f827b45132-03
panel-grid-cell pg-w5be412395acbb-0 panel-row-style3
panel-grid-cell pg-w5b8f827b45132-0 panel-row-style3
panel-grid-cell pg-w5b8f8ad2dec76-0 panel-row-style3
pg-w5be412395acbb-0 panel-grid-cell pg-w5be412395acbb-03
formations du respadd3
panel-grid-cell pg-w5bfe50bd26fc6-1 panel-row-style3
pg-w5b8f8ad2dec76-0 panel-grid-cell pg-w5b8f8ad2dec76-03
panel-grid-cell pg-w5bae4ecd64c67-2 panel-row-style3
sant adhrer au3
pharmaciens et addictions3
rduction des risques3
pg-w5bae4ecd64c67-0 panel-grid-cell pg-w5bae4ecd64c67-03
panel-grid-cell pg-w5bae4ecd64c67-0 panel-row-style3
pg-w5bae4ecd64c67-1 panel-grid-cell pg-w5bae4ecd64c67-13
panel-grid-cell pg-w5bae4ecd64c67-1 panel-row-style3
pg-w5bae4ecd64c67-2 panel-grid-cell pg-w5bae4ecd64c67-23
padding30px 0px 0px3
panel-grid-cell pg-w5bfe50bd26fc6-3 panel-row-style3
0px media max-width780px3
pg-w5bfe50bd26fc6-0 panel-grid-cell pg-w5bfe50bd26fc6-03
panel-grid-cell pg-w5bfe50bd26fc6-0 panel-row-style3
pg-w5bfe50bd26fc6-1 panel-grid-cell pg-w5bfe50bd26fc6-13
lettre du respadd3
pg-w5bfe50bd26fc6-2 panel-grid-cell pg-w5bfe50bd26fc6-23
panel-grid-cell pg-w5bfe50bd26fc6-2 panel-row-style3
pg-w5bfe50bd26fc6-3 panel-grid-cell pg-w5bfe50bd26fc6-33
panel-grid-cell pg-w5be412395acbb-3 panel-row-style3
panel-row-style panel-grid-cell34
panel-row-style panel-grid-celllast-child17
media max-width780px9
panel-grid-cell margin-bottom30px9
panel-grid-cell floatnonewidthauto9
so-panel margin-bottom30px9
panel-grid panel-grid-cell-mobile-last9
panel-grid-cell-empty displaynone9
panel-grid-cell padding-left15pxpadding-right15px9
so-panellast-child margin-bottom0px9
panel-grid panel-grid-cell-empty9
panel-grid-cell padding09
panel-grid margin-left0margin-right09
panel-grid-celllast-child margin-bottom0px9
0px 0px8
margin-bottom30px layout8
du respadd8
et addictions7
sant promoteur7
sans tabac7
sant sans7
margin-bottom0px media6
panel-grid-cell pg-w5bae4ecd64c67-25
panel-grid-cell pg-w5bfe50bd26fc6-15
panel-grid-cell pg-w5bae4ecd64c67-15
panel-grid-cell pg-w5bfe50bd26fc6-35
panel-grid-cell pg-w5be412395acbb-15
panel-grid-cell pg-w5be412395acbb-25
panel-grid-cell pg-w5be412395acbb-35
panel-grid-cell pg-w5bfe50bd26fc6-25
pg-w5bfe50bd26fc6-2 panel-row-style4
pg-w5bfe50bd26fc6-3 panel-row-style4
pg-w5be412395acbb-2 panel-row-style4
pg-w5be412395acbb-3 panel-row-style4
le rseau4
padding30px 0px4
panel-row-style padding30px4
pg-w5bae4ecd64c67-2 panel-row-style4
2020 actualitsactualits4
pl-w5bae4ecd64c67 panel-grid3
panel-grid-cell pg-w5b8f827b45132-03
panel-grid-cell pg-w5b8f88e4c19b6-03
pg-w5b8f88e4c19b6-0 panel-grid-cell3
pl-w5b8f827b45132 panel-grid3
pg-w5b8f827b45132-0 panel-row-style3
pg-w5b8f8ad2dedcb-0 panel-row-style3
pg-w5b8f827b45132-0 panel-grid-cell3
pl-w5b8f8ad2dedcb panel-grid3
panel-grid-cell pg-w5b8f8ad2dedcb-03
pg-w5b8f8ad2dedcb-0 panel-grid-cell3
pl-w5b8f8ad2ded5d panel-grid3
pg-w5b8f88e4c19b6-0 panel-row-style3
pg-w5be412395acbb-0 panel-grid-cell3
pl-w5b8f88e4c19b6 panel-grid3
panel-grid-cell pg-w5b8f8ad2ded5d-03
panel-grid-cell pg-w5be412395acbb-03
pg-w5be412395acbb-0 panel-row-style3
pharmaciens et3
pg-w5be412395acbb-1 panel-grid-cell3
pg-w5be412395acbb-1 panel-row-style3
adhrer au3
pg-w5be412395acbb-2 panel-grid-cell3
sant adhrer3
agir addictions3
pg-w5be412395acbb-3 panel-grid-cell3
lettre du3
pg-w5b8f8ad2ded5d-0 panel-row-style3
pg-w5b8f8ad2decee-0 panel-row-style3
pg-w5b8f8ad2ded5d-0 panel-grid-cell3
pg-w5bae4ecd64c67-0 panel-grid-cell3
pg-w5bae4ecd64c67-2 panel-grid-cell3
pg-w5bae4ecd64c67-1 panel-row-style3
pg-w5bae4ecd64c67-1 panel-grid-cell3
pg-w5bae4ecd64c67-0 panel-row-style3
panel-grid-cell pg-w5bae4ecd64c67-03
pg-w5bfe50bd26fc6-0 panel-grid-cell3
panel-grid-cell pg-w5bfe50bd26fc6-03
pg-w5bfe50bd26fc6-0 panel-row-style3
formations du3
pg-w5bfe50bd26fc6-1 panel-grid-cell3
pg-w5bfe50bd26fc6-1 panel-row-style3
pg-w5bfe50bd26fc6-2 panel-grid-cell3
pl-w5b8f8ad2decee panel-grid3
des risques3
pg-w5bfe50bd26fc6-3 panel-grid-cell3
rduction des3
pl-w5bfe50bd26fc6 panel-grid3
pg-w5b8f8ad2dec76-0 panel-grid-cell3
panel-grid-cell pg-w5b8f8ad2dec76-03
pg-w5b8f8ad2dec76-0 panel-row-style3
reprage et3
pl-w5b8f8ad2dec76 panel-grid3
pg-w5b8f8ad2decee-0 panel-grid-cell3
panel-grid-cell pg-w5b8f8ad2decee-03
0px media3
pl-w5be412395acbb panel-grid3
panel-grid-cell103
panel-row-style56
sant33
et32
panel-grid27
margin-bottom0px18
margin-bottom30px18
panel-grid-celllast-child17
des17
0px14
respadd14
lieu13
actualitsactualits12
addictions12
du11
margin-left0margin-right09
panel-grid-cell-mobile-last9
padding09
panel-grid-cell-empty9
displaynone9
max-width780px9
layout9
media9
so-panel9
tabac9
pg-w5bfe50bd26fc6-29
margin-left-15pxmargin-right-15px9
padding-left15pxpadding-right15px9
pg-w5be412395acbb-29
so-panellast-child9
floatnonewidthauto9
pg-w5bae4ecd64c67-08
pg-w5bae4ecd64c67-28
pg-w5bfe50bd26fc6-08
pg-w5bfe50bd26fc6-18
pg-w5bae4ecd64c67-18
pg-w5bfe50bd26fc6-38
pg-w5be412395acbb-38
formations8
pg-w5be412395acbb-18
pg-w5be412395acbb-08
pl-w5bfe50bd26fc67
actualits7
pl-w5be412395acbb7
pl-w5b8f88e4c19b67
revue7
pg-w5b8f88e4c19b6-07
sans7
pl-w5b8f827b451327
rseau7
pl-w5bae4ecd64c677
pg-w5b8f827b45132-07
pl-w5b8f8ad2dedcb7
promoteur7
pg-w5b8f8ad2dedcb-07
pl-w5b8f8ad2ded5d7
pg-w5b8f8ad2ded5d-07
pl-w5b8f8ad2decee7
pg-w5b8f8ad2decee-07
pl-w5b8f8ad2dec767
pg-w5b8f8ad2dec76-07
width6849326
width3150686
le6
documentwrite6
nos6
publications6
promotion6
05
thmatiques5
rduction5
risques4
audit4
lettre4
rpib4
padding30px4
c4
colloques4
colloque4
moissanstabac3
documentbodyclassname3
qui3
function3
resizefullimage3
accs3
agir3
lsps3
presse3
les3
adhrer3
au3
inscription3
adolescence3
width1003
reprage3
auto-valuation3
agenda3
pharmaciens3

Who hosts Respadd.org?

Respadd.org Hosting Provider Information

Hosted IP Address:51.254.126.156
Hosted Hostname:respadd.org
Service Provider:OVH SAS
Hosted Country:FranceFR
Location Latitude:48.8582
Location Longitude:2.3387
Webserver Software:nginx

Is "OVH SAS" in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%
OVH SAS
1.2969%

HTTP Header Analysis for Respadd.org

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Server: nginx
Date: Fri, 30 Oct 2020 10:42:22 GMT
Content-Type: text/html
Content-Length: 162
Connection: keep-alive
Location: https://www.respadd.org/

Respadd.org Domain Nameserver Information

HostIP AddressCountry
sdns2.ovh.net 213.251.188.141


Need to find out who hosts Respadd.org?


Domain Registration (WhoIs) information for Respadd.org

 Domain Name: RESPADD.ORG
Registry Domain ID: D156456542-LROR
Registrar WHOIS Server: whois.gandi.net
Registrar URL: http://www.gandi.net
Updated Date: 2020-06-03T11:57:45Z
Creation Date: 2009-06-18T16:30:18Z
Registry Expiry Date: 2021-06-18T16:30:18Z
Registrar Registration Expiration Date:
Registrar: Gandi SAS
Registrar IANA ID: 81
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +33.170377661
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization: RESEAU HOPITAL SANS TABAC ET ADDICTIONS
Registrant State/Province:
Registrant Country: FR
Name Server: SDNS2.OVH.NET
Name Server: VPS276662.OVH.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-09-29T17:06:40Z

Websites with Similar Names

Respa-tila-talk.com
Regulatory Resources
Respa.click
Power Lead System
Respa.online
respa.online
Respaattorneys.com
RESPA Lawyer | Real Estate Settlement & Procedures Act Attorney | Sterbcow Law Group
Respacare.net
Respacare Of New Jersey - Respacare
Respace.co.kr
리스페이스(Respace)

Recently Updated Websites

Jeypsdelacruz.com (3 seconds ago.)Hunzasproducts.com (5 seconds ago.)Laurajanemidkiff.com (7 seconds ago.)Kwisterphotography.com (7 seconds ago.)Istandd.com (7 seconds ago.)Ldapp532.com (9 seconds ago.)Jerseyhomepreservation.com (11 seconds ago.)Lc-07.com (12 seconds ago.)Legacyfinancialservicesllc.com (12 seconds ago.)Jelly-fruit.com (13 seconds ago.)Inventorytechcenter.com (16 seconds ago.)Instantcbddealer.com (17 seconds ago.)Jaderoller-factory.com (18 seconds ago.)Lets-try-it.com (19 seconds ago.)Ldapp629.com (21 seconds ago.)Kmxiumeidi.com (21 seconds ago.)Kiserudanang.com (22 seconds ago.)Jbsstorage.com (23 seconds ago.)La-infosec.com (23 seconds ago.)Ksquaredonline.com (23 seconds ago.)Httpwww3oulastore.com (27 seconds ago.)Leftyknits.com (28 seconds ago.)Jcatara.com (28 seconds ago.)Ksrassia.com (30 seconds ago.)Ldapp626.com (32 seconds ago.)Helpingthemasses.com (34 seconds ago.)Lady-hamilton.com (35 seconds ago.)Jdehomesolutions.com (37 seconds ago.)Jonesdesignworx.com (39 seconds ago.)Johnstoneproposeyd.com (42 seconds ago.)

Recently Searched Keywords

save $19.99 (3 seconds ago.)укладка ламината (4 seconds ago.)go (5 seconds ago.)九州app官网-上海疾控中心:不建议网购所谓快检试剂盒自行检测 (7 seconds ago.)excelcalcs (8 seconds ago.)how to clean gl top stove burnt … (12 seconds ago.)sahibinden kiralık araba bursa (12 seconds ago.)tips iconicon-bang (13 seconds ago.)30 cooktop cutout dimensions (14 seconds ago.)jinshanciba (15 seconds ago.)36 inch (15 seconds ago.)melted plastic (16 seconds ago.)intersticio renal (16 seconds ago.)jinshanciba free download (17 seconds ago.)sahibinden kiralık araba ankara (18 seconds ago.)intersticio (19 seconds ago.)counter trim (19 seconds ago.)laminate countertop (20 seconds ago.)postgraduate applications (20 seconds ago.)track and field (22 seconds ago.)itemstitlejuanitas tortilla chipslinktargetblanktypewixdatapageidchhjdtargetselftypepagelinkpagenamejuanitas (28 seconds ago.)drbnler (31 seconds ago.)yele (39 seconds ago.)live flight tracking (39 seconds ago.)between (39 seconds ago.)west (port-au-prince) (40 seconds ago.)harbor (42 seconds ago.)tx 78613 chinese pickup delivery order chinese food pickup delivery (46 seconds ago.)manhadunyulecheng558 (46 seconds ago.)incluido context httpschemaorg (47 seconds ago.)