Rev-A-Shelf Products - Largest Selection of Cabinet Organizers | CabinetParts.com

Safety: Low trust score
Year Founded: 2004
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Shop and Save on Our Wide Selection of Rev-A-Shelf Products - Largest Selection of Cabinet Organizers. Discover Great Prices, Special Offers & Best Customer Service



Domain summary

Last updated
2021-09-17
Domain label
revashelf
Domain extension
net
Domain registered:
2004-02-20
Domain updated:
2021-02-21
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Revashelf.net registered?
A: Revashelf.net was registered 17 years, 7 months, 4 weeks, 22 hours, 31 minutes, 38 seconds ago on Friday, February 20, 2004.
Q: When was the WHOIS for Revashelf.net last updated?
A: The WHOIS entry was last updated 7 months, 3 weeks, 5 days, 22 hours, 31 minutes, 38 seconds ago on Sunday, February 21, 2021.
Q: What are Revashelf.net's nameservers?
A: DNS for Revashelf.net is provided by the following nameservers:
  • ns1.p27.dynect.net
  • ns2.p27.dynect.net
  • ns3.p27.dynect.net
  • ns4.p27.dynect.net
Q: Who is the registrar for the Revashelf.net domain?
A: The domain has been registered at GODADDY.COM, LLC.
Q: What is the traffic rank for Revashelf.net?
A: Revashelf.net has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Revashelf.net each day?
A: Revashelf.net receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Revashelf.net resolve to?
A: Revashelf.net resolves to the IPv4 address .
Q: In what country are Revashelf.net servers located in?
A: Revashelf.net has servers located in the .
Q: What webserver software does Revashelf.net use?
A: Revashelf.net is powered by Apache/2.2.15 (CentOS) webserver.
Q: Who hosts Revashelf.net?
A: Revashelf.net is hosted by Unknown in .
Q: How much is Revashelf.net worth?
A: Revashelf.net has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Revashelf.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Revashelf.net Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Revashelf.net

H1 Headings

1 :
  1. Cabinet Organizers

H2 Headings

3 :
  1. Kitchen Organizers
  2. Closet Organizers
  3. Manufacturer

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

10 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-126695-1

Links - Outbound

95:

Keyword Cloud for Revashelf.net

87afontsizeccont cusdept suboptionshowtomccontfunctionpaddingallnow nbsp48 87a 52mediahalfboxpull outviewccont cusdept suboptionsdisplaycabinet organizers shopsuboptions halfbox87a 48 87amaxwidthbyour2pxorganizers shopscreen and maxwidthstorageview allcusdepttransparent 52pullmedia screenkitchen652 backgroundimagewidth 95color 333shelforganizers shop nowffffffaindexof52 transparent 523shop now nbspshop nowslidesclosetnewsuboptions48 87apositionleftmargin 0bracketssuboptionshowtoecececborder 0415px5cusdept suboptions87a 521auto border 087a 52 transparentoutsolid cccfffracks shop nowracks shoptextalign centercolormargin 0 auto48 87a 48backgroundautocusdept suboptions halfbox0racksorganizersnullscreen20 autonbsptransparent1pxnowvar1px soliddrawer slidesaccountmarginlineheightcabinetcentertransparent 52 backgroundimagebackgroundimagesolidhingesauto border5pxwidthcusdept suboptionshowtotablecccdrawercloset organizers25pxccabinet organizersborder52 transparentshop87a 48ccont cusdeptwidth100whitespacetextalign

Longtail Keyword Density for Revashelf.net

KeywordsOccurences
ccont cusdept suboptions16
organizers shop now8
cusdept suboptions halfbox6
ccont cusdept suboptionshowto6
racks shop now5
52 transparent 525
shop now nbsp4
48 87a 484
87a 48 87a4
48 87a 524
87a 52 transparent4
transparent 52 background-image4
screen and max-width3
cabinet organizers shop3
auto border 03
margin 0 auto3
ccont cusdept28
shop now26
cusdept suboptions16
48 87a8
organizers shop8
view all7
solid ccc6
suboptions halfbox6
text-align center6
cusdept suboptionshowto6
52 transparent5
transparent 525
racks shop5
cabinet organizers4
87a 484
now nbsp4
52 background-image4
87a 524
border 03
drawer slides3
color 3333
pull out3
auto border3
width 953
margin 03
0 auto3
media screen3
closet organizers3
1px solid3
ccont30
cusdept28
shop27
now26
organizers17
suboptions16
width14
012
all10
solid10
110
210
view9
background8
padding8
b8
87a8
margin8
function7
cabinet7
color7
display7
transparent7
auto7
center7
ccc6
halfbox6
font-size6
nbsp6
36
text-align6
border6
c6
drawer6
suboptionshowto6
racks5
background-image5
45
kitchen5
null4
m4
line-height4
table4
screen4
25px4
your4
out4
max-width4
ffffff4
5px3
1px3
fff3
15px3
position3
2px3
left3
var3
ececec3
white-space3
53
63
storage3
pull3
media3
shelf3
closet3
brackets3
slides3
hinges3
account3
new3
aindexof3
width1003

Who hosts Revashelf.net?

Revashelf.net Hosting Provider Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Unknown
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:Apache/2.2.15 (CentOS)

Is "Unknown" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
15.4249%
Unknown
11.7059%
AS-26496-GO-DADDY-COM-LLC
4.1307%
NAMECHEAP-NET
3.3122%
AMAZON-AES
2.5118%
GoDaddy.com, LLC
2.1535%
UNIFIEDLAYER-AS-1
2.1315%
Fara Negar Pardaz Khuzestan
1.7839%
CONFLUENCE-NETWORK-INC
1.5636%
1&1 Internet AG
1.4878%

HTTP Header Analysis for Revashelf.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 17 Sep 2021 17:07:56 GMT
Server: Apache/2.2.15 (CentOS)
Cache-Control: private, max-age=3600
Vary: Accept-Encoding
Content-Encoding: gzip
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Revashelf.net Domain Nameserver Information

HostIP AddressCountry
ns1.p27.dynect.net 208.78.70.27
ns2.p27.dynect.net 204.13.250.27
ns3.p27.dynect.net 208.78.71.27
ns4.p27.dynect.net 204.13.251.27


Need to find out who hosts Revashelf.net?


Domain Registration (WhoIs) information for Revashelf.net

 Domain Name: REVASHELF.NET
Registry Domain ID: 112231547_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2021-02-21T18:34:56Z
Creation Date: 2004-02-20T14:12:01Z
Registry Expiry Date: 2022-02-20T14:12:01Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS1.P27.DYNECT.NET
Name Server: NS2.P27.DYNECT.NET
Name Server: NS3.P27.DYNECT.NET
Name Server: NS4.P27.DYNECT.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2021-09-17T17:07:40Z

Websites with Similar Names

Revas-ci.com
revas-ci.com -&nbspThis website is for sale! -&nbsprevas ci Resources and Information.
Revas.co.nz
Reva's on the waterfront
Revas.co.uk
404 - File or directory not found.
Revas.pro
Temporarily Disabled
Revasale.site
Сайта с таким именем нет на сервере

Recently Updated Websites

Restaurants.biz (3 seconds ago.)Hangkhong247.com (7 seconds ago.)Covalentpkg.org (7 seconds ago.)Rebekahenoch.com (8 seconds ago.)Trenty.life (8 seconds ago.)Thechivalrybox.com (9 seconds ago.)Sosrainforestlive.net (11 seconds ago.)Saksanseisoja.com (12 seconds ago.)Christiandaviescreative.com (14 seconds ago.)Endervid.com (14 seconds ago.)Triple123.com (16 seconds ago.)Arizonabridalshow.com (16 seconds ago.)Healthaxioms.com (17 seconds ago.)Fmecoatings.com (18 seconds ago.)Thestationarms.co.uk (18 seconds ago.)Topnewoffer.com (19 seconds ago.)Concordfuneral.net (19 seconds ago.)Monster-dog-miami.com (20 seconds ago.)B4u.law (20 seconds ago.)Brazil777.com (21 seconds ago.)Rsvvacinnestudy.com (22 seconds ago.)Leyuvip1460.com (22 seconds ago.)Rollnplay.com (25 seconds ago.)360realtour.com (29 seconds ago.)Novayr.com (31 seconds ago.)Bubeb.com (31 seconds ago.)Brigaderesidencesatwtc.com (35 seconds ago.)Fidayani.com (38 seconds ago.)Institutodepediatria.com (38 seconds ago.)Hamita-studio.com (38 seconds ago.)

Recently Searched Keywords

mentioned not mentioned (4 seconds ago.)150 years of christian brother  (4 seconds ago.)мадридский реал в примера дивизионе лидирует по количеству травм за сезон мадридский  (5 seconds ago.)color ffffffdivalempanelsitefiyatlar-3 divpackagedetails (5 seconds ago.)dreamscape dubai (7 seconds ago.)doktorsitesi.com (8 seconds ago.)para fornecer (8 seconds ago.)system (9 seconds ago.)ljn-principal-item-img float left (10 seconds ago.)subic bay (12 seconds ago.)aircanada flights (13 seconds ago.)contextkeycontext-bs-1 radpack (14 seconds ago.)東京都港区赤坂2-14-5 daiwa赤坂ビル1f (15 seconds ago.)0-- -- gt (17 seconds ago.)88car (18 seconds ago.)персональные (в сборе) (19 seconds ago.)maisons du monde france magasins (23 seconds ago.)ðð¾ð²ð¾ññ‚ð¸ (25 seconds ago.)our cocktails (27 seconds ago.)beauty brands (28 seconds ago.)engelsk (28 seconds ago.)stucco mysublistx0 stritem (28 seconds ago.)εξαρτήματα dremel (29 seconds ago.)ce site (29 seconds ago.)trades amp (29 seconds ago.)good idea (31 seconds ago.)boiling (33 seconds ago.)百科知識 (35 seconds ago.)u0936u0947u092fu0930 (36 seconds ago.)oberhausen (37 seconds ago.)