Revineking.net  |  Revine King
Low trust score  | 
Bu harika videolar? izlemeden geçmeyin!

Revineking.net Website Information

Revineking.net has a Low Trust Score, a Statvoo Rank of E, an Alexa Rank of 98,475, a Majestic Rank of 0, a Domain Authority of 14% and is not listed in DMOZ.

Revineking.net is hosted by GoDaddy.com, LLC in Arizona, Scottsdale, United States, 85260.
Revineking.net has an IP Address of 50.63.202.31 and a hostname of ip-50-63-202-31.ip.secureserver.net.

The domain revineking.net was registered 4 years 7 months 2 weeks ago by , it was last modified 4 years 7 months 2 weeks ago and currently is set to expire 3 years 7 months 2 weeks ago.


Whois information for revineking.net

Full Whois Lookup for Revineking.net Whois Lookup

Domain Name: REVINEKING.NET
Registry Domain ID: 1893208465_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2016-10-10T12:33:59Z
Creation Date: 2014-12-30T09:04:35Z
Registry Expiry Date: 2017-12-30T09:04:35Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS29.DOMAINCONTROL.COM
Name Server: NS30.DOMAINCONTROL.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-10-19T22:36:42Z

Who hosts Revineking.net?

Revineking.net Web Server Information

Hosted IP Address:50.63.202.31
Hosted Hostname:ip-50-63-202-31.ip.secureserver.net
Service Provider:GoDaddy.com, LLC
Hosted Country:United StatesUS
Location Latitude:33.6013
Location Longitude:-111.8867
Webserver Software:Not Applicable

HTTP Header Analysis for Revineking.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Content-Type: text/html; charset=UTF-8
Expires: Sun, 21 Jun 2015 03:45:24 GMT
Date: Sun, 21 Jun 2015 03:45:24 GMT
Cache-Control: private, max-age=0
Last-Modified: Thu, 11 Jun 2015 09:13:53 GMT
X-Content-Type-Options: nosniff
X-XSS-Protection: 1; mode=block
Server: GSE
Alternate-Protocol: 80:quic,p=0
Accept-Ranges: none
Vary: Accept-Encoding
Transfer-Encoding: chunked


Need to find out who hosts Revineking.net?

Revineking.net Free SEO Report

Website Inpage Analysis for Revineking.net

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:pub-0588759408184528
Google Analytics:Not Applicable

Keyword Cloud for Revineking.net

0rgba255payla target1px 3px rgba0trreturnvar255 01 01px2searchbhinset0 rgba255 2551px 0urltwitter255 2553pxiin0 0displaymodefull013revine3px rgba0 0all 07s ease01 0 1pxtitlex3dx22revine king3px rgba001 007s ease6pxnull0 1pxrgba255 255 255leftpositionkeyallplatformunda paylaburgba0 0blogthisakakadnheight02title0 1px 3pxpinterestease 0splatformundaease255 01107s ease 0s0 1px 0rgba0 0 0falsewidthsharemessage1px 0 rgba255rgba0data255 255 01revine kingfalse var0 021px 3pxtitlex3dx22revinetruefacebookplatformunda payla targettoppositionmkemmel07sall 07s0 rgba2550 0 02normal0stargetx3enx3clinkokbir20px0 02 insetnamehttpwwwrevinekingnetinsanrgba255 255ilenewvideo02 insetpaylakingreklam

Longtail Keyword Density for Revineking.net

KeywordsOccurences
rgba0 0 04
all 07s ease4
07s ease 0s4
platformunda payla target4
0 1px 03
1px 0 rgba2553
0 rgba255 2553
rgba255 255 2553
255 255 013
255 01 03
01 0 1px3
0 1px 3px3
1px 3px rgba03
3px rgba0 03
0 0 023
0 02 inset3
0 1px6
rgba0 04
0 04
platformunda payla4
revine king4
false var4
ease 0s4
07s ease4
all 07s4
payla target4
1px 3px3
0 023
02 inset3
01 03
255 013
255 2553
rgba255 2553
0 rgba2553
titlex3dx22revine king3
1px 03
3px rgba03
false28
name19
019
var18
bir18
true11
url9
target7
key7
sharemessage7
king7
16
bu6
1px6
data5
all5
httpwwwrevinekingnet5
aka5
width5
payla4
video4
pinterest4
twitter4
24
34
topposition4
leftposition4
rgba04
revine4
ease4
07s4
facebook4
platformunda4
0s4
x3enx3clink3
new3
titlex3dx22revine3
null3
blogthis3
mkemmel3
ile3
023
return3
searchbh3
6px3
20px3
rgba2553
013
3px3
inset3
reklam3
height3
title3
tr3
iin3
kadn3
normal3
insan3
ok3
displaymodefull3

What are the nameservers for revineking.net?

Revineking.net Domain Nameserver Information

HostIP AddressCountry
ns29.domaincontrol.com 97.74.104.15United States United States
ns30.domaincontrol.com 173.201.72.15United States United States

Revineking.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Revineking.net is a scam?