Ripoffreport.com  |  Ripoff Report | Scams, reviews, complaints, lawsuits and frauds. File a report, post your review. Consumers educating consumers.
Low trust score  | 
Want justice!? Report any scam, fraud, complaint or review on any type of company, individual, service or product here. The Ripoff Report allows you a central place to enter complaints about companies or individuals who are fraudulent, scamming or ripping people off. Our reports cover every category imaginable! Submit your story on our web site ...




Ripoffreport.com Website Information

Website Ranks & Scores for Ripoffreport.com

Statvoo Rank Statvoo Rank:C
Alexa Rank Alexa Rank:19,055
Majestic Rank Majestic Rank:2,588
Domain Authority Domain Authority:75%
DMOZ DMOZ Listing:No

Domain Information for Ripoffreport.com

Domain Registrar: DNC HOLDINGS, INC.
Registration Date:1998-12-09  2 decades 2 months 1 week ago
Last Modified:2010-02-01  9 years 2 weeks 3 days ago
Expiration Date:2016-12-08  2 years 2 months 1 week ago

Whois information for ripoffreport.com

Full Whois Lookup for Ripoffreport.com Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Ripoffreport.com. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: RIPOFFREPORT.COM
Registry Domain ID: 3406735_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.directnic.com
Registrar URL: http://www.directnic.com
Updated Date: 2016-10-24T06:05:10Z
Creation Date: 1998-12-09T05:00:00Z
Registry Expiry Date: 2017-12-08T05:00:00Z
Registrar: DNC Holdings, Inc.
Registrar IANA ID: 291
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: ADEL.NS.CLOUDFLARE.COM
Name Server: AJAY.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-08-23T22:26:17Z

Who hosts Ripoffreport.com?

Ripoffreport.com is hosted by Voxel Dot Net, Inc. in Virginia, Arlington, United States, 22203.
Ripoffreport.com has an IP Address of 192.225.215.36 and a hostname of 192.225.215.36.



Ripoffreport.com Web Server Information

Hosted IP Address:192.225.215.36
Hosted Hostname:192.225.215.36
Service Provider:Voxel Dot Net, Inc.
Hosted Country:United StatesUS
Location Latitude:38.875
Location Longitude:-77.113
Webserver Software:Not Applicable
Google Map of 50,12

Websites Hosted on Same IP (i.e. 192.225.215.36)

Ed Magedson
- edmagedson.com

  2,533,553   $ 480.00

Ripoff Report | Scams, reviews, complaints, lawsuits and frauds....
- badbusinessbureau.com

Want justice!? Report any scam, fraud, complaint or review on any type of company, individual, service or product here. The Ripoff Report allows you a central place to enter...

  1,639,643   $ 480.00

HTTP Header Analysis for Ripoffreport.com

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Thu, 11 Jun 2015 01:29:25 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Cache-Control: private, no-cache, no-store, proxy-revalidate, no-transform
Iden: web2
Pragma: no-cache
Vary: User-Agent,Accept,Accept-Encoding
X-Powered-By: PHP/5.4.40
X-Distil-CS: MISS


Need to find out who hosts Ripoffreport.com?

Ripoffreport.com Free SEO Report

Website Inpage Analysis for Ripoffreport.com

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Ripoffreport.com

newport beach californiabeegleworldregandoyour ripoff reportopportunitybesttheyfiledbeachlatesttopwowwsiteinternet 082317ripoff report corporatemyellys worldletpatrick tenorecustomer satisfaction programcashreportbusiness remediationwant to suecompany or individuallawsuitadvocacy business remediationyou cantitletakeallmoneynotfirstavailablemoremembermore thanyoujquerydocumentreadyfunctionuneditedbeforeeverymakecompletehavegiventenoreaccountits boguscall082317 nationwidemaycanstatementssincelikereadingthem of completecorporatelawyerscorporate advocacy programbeach californiawedontadvocacy businessmedicalreadinternetcaliforniacontact uswebsitethenverifiedreports filedconfidencefraudattorneysdoing businessmediaway3scamshanoldreport corporate advocacyanymanyyouvebusinessellysfactseeinformationcapitalgoodrightpatrickfilingagainstusemployeescomplete satisfactionsatisfactiontimeincludingfreepostedimportantnewportservicesmustsatisfaction and confidencecompanybenefitsfalseupdaterebuttalclasshelpnowbrowseoriginalnewsbusiness with themagencies1stateusingprogramssatisfaction programresourcesregan hanold beeglecomplaintsrealstatusseenadvocacy programmedical academylocalbankissueseducateddo businessreport does notyou the consumerjusticeyou wantalsoultimatefinancialadvocacyconsumersdirectoryitscorporate advocacy businessmember businesstrueconsumerprogrammostcorporate advocacyboth082317ultimate medicalexperiencearbitrationwantbutreport corporatereport youfilenationwideshouldfeaturedenginesreviewsarbitration programnationalverified statusmistakesreal estatewould likestoryfile a reportacademyspecificadvantagevictimsifhasvictimnewport beachconfidence when doingusahanold beeglenewprogram that benefitsgeneralsearch enginesyour reportjustrepair yourcountrycalifornia 082317doesampbadbogushometheirviprespondscamyou haveestatecontactedreport doesbenefits the consumerreportsvip arbitrationbeensearchdecisionourreputationripoffultimate medical academyotherverypremiumindividualfederalbecauseinvestigationuseknowoptionsnumberripoff reportarbitratorcommunicationsremediationlawyourif youripoff reportsneed0beingdoes nottvcalifornia 082317 internetgovernment agenciesout082317 internetgiven the opportunitythosecompanieslatest reportsvararbitratorslinkinterestedyour ripoffstatements of factlawsuitsaroundbusinessesthanfalse statementsreportingclass actiontheregovernment2onlywouldthemreport ifreviewactionsueblckconcustomercustomer satisfactionreporteddoingregan hanoldcontactclickcreditrepairgetone

Longtail Keyword Density for Ripoffreport.com

KeywordsOccurences
company or individual7
corporate advocacy program7
your ripoff report6
newport beach california5
ultimate medical academy5
corporate advocacy business4
file a report4
advocacy business remediation4
customer satisfaction program4
report does not4
statements of fact4
given the opportunity3
california 082317 internet3
regan hanold beegle3
business with them3
want to sue3
report corporate advocacy3
benefits the consumer3
program that benefits3
them of complete3
satisfaction and confidence3
ripoff report corporate3
confidence when doing3
you the consumer3
ripoff report51
corporate advocacy12
rip-off report8
if you8
advocacy program7
you can7
your ripoff6
your report6
ripoff reports6
you want5
newport beach5
beach california5
ultimate medical5
reports filed5
do business5
medical academy5
real estate4
report you4
082317 internet4
false statements4
internet 0823174
patrick tenore4
class action4
doing business4
satisfaction program4
advocacy business4
does not4
customer satisfaction4
report does4
vip arbitration4
business remediation4
contact us3
repair your3
regan hanold3
latest reports3
082317 nationwide3
verified status3
ellys world3
hanold beegle3
california 0823173
would like3
member business3
report corporate3
government agencies3
search engines3
more than3
arbitration program3
report if3
complete satisfaction3
you have3
its bogus3
report89
you64
ripoff58
business36
your32
reports28
consumers27
program25
them19
not18
they18
company17
information17
all17
consumer16
can16
if15
we15
file14
get13
do13
amp13
advocacy12
corporate12
want12
have12
false11
complaints11
more11
its11
var11
search11
bank11
us10
make10
businesses10
reported10
08231710
individual10
internet9
rip-off9
credit9
hanold9
because8
first8
many8
just8
has8
our8
may8
know7
satisfaction7
like7
filing7
agencies7
their7
filed7
medical7
media7
arbitrator7
real7
statements7
verified7
reputation7
right7
see7
victims7
those7
california6
nationwide6
every6
world6
than6
true6
posted6
my6
tv6
out6
local6
then6
class6
other6
best6
contact6
customer6
arbitration6
free6
only5
been5
against5
beach5
regan5
government5
tenore5
newport5
opportunity5
fact5
new5
services5
money5
help5
financial5
beegle5
rebuttal5
any5
way5
including5
ultimate5
home5
does5
academy5
most5
05
capital5
decision5
companies4
available4
news4
read4
reporting4
one4
respond4
click4
important4
sue4
link4
should4
vip4
attorneys4
story4
seen4
options4
repair4
action4
patrick4
also4
state4
remediation4
law4
estate4
woww4
good4
update4
doing4
let4
interested4
lawsuits4
dont3
must3
youve3
browse3
since3
review3
reading3
call3
advantage3
would3
being3
13
jquerydocumentreadyfunction3
23
premium3
blckcon3
ellys3
33
featured3
cash3
communications3
national3
country3
latest3
bogus3
reviews3
usa3
scams3
investigation3
fraud3
complete3
before3
using3
benefits3
employees3
mistakes3
lawsuit3
scam3
lawyers3
confidence3
member3
both3
site3
justice3
victim3
educated3
use3
account3
now3
unedited3
number3
bad3
contacted3
status3
time3
there3
given3
website3
title3
federal3
programs3
very3
original3
experience3
arbitrators3
specific3
top3
take3
around3
but3
directory3
engines3
general3
issues3
resources3
need3

What are the nameservers for ripoffreport.com?

Ripoffreport.com Domain Nameserver Information

HostIP AddressCountry
udns1.ultradns.net 204.69.234.1United States United States
udns2.ultradns.net 204.74.101.1United States United States

Ripoffreport.com DNS Record Analysis DNS Lookup

HostTypeTTLExtra
ripoffreport.comA14386IP: 192.225.215.36
ripoffreport.comNS86400Target: pdns1.ultradns.net
ripoffreport.comNS86400Target: pdns2.ultradns.net
ripoffreport.comNS86400Target: pdns3.ultradns.org
ripoffreport.comNS86400Target: pdns4.ultradns.org
ripoffreport.comNS86400Target: pdns5.ultradns.info
ripoffreport.comNS86400Target: pdns6.ultradns.co.uk
ripoffreport.comSOA14400MNAME: udns1.ultradns.net
RNAME: editor.ripoffreport.com
Serial: 2013091026
Refresh: 10800
Retry: 3600
Expire: 604800
ripoffreport.comMX9000Priority: 40
Target: d10199a.ess.barracudanetworks.com
ripoffreport.comMX9000Priority: 30
Target: d10131b.ess.barracudanetworks.com
ripoffreport.comMX9000Priority: 20
Target: d10131a.ess.barracudanetworks.com
ripoffreport.comTXT900TXT: google-site-verification=uGCzF_taShcW3TU
oDffqjhxCXhxhvqxKQ1c4eiHOMb8
ripoffreport.comTXT800TXT: google-site-verification=2lzEPryzfH3KlL-
b8wodQMkiChIonDVrKuaNq0Ap1ec
ripoffreport.comTXT900TXT: v=spf1 include:sendgrid.net
include:spf.mailjet.com mx
a:senders.ripoffreport.com
mx:d10131a.ess.barracudanetworks.com
mx:d10131b.ess.barracudanetworks.com
mx:d10199a.ess.barracudanetworks.com
include:spf.mandrillapp.com+all

Alexa Traffic Rank for Ripoffreport.com


Alexa Search Engine Traffic for Ripoffreport.com