РИВ ГОШ - Магазин парфюмерии и косметики

РИВ ГОШ - Магазин парфюмерии и косметики. Большой выбор и лучшие цены! Скидки, подарки и акции в РИВ ГОШ.


Domain summary

SafetyLow trust score
Year Founded
2001
Global Traffic Rank
45,766
Estimated Worth
$331,920
Last updated
2021-08-20
Domain label
rivegauche
Domain extension
ru
Domain registered:
2001-09-25
Domain updated:
2021-08-20
Domain expires:
2021-09-26
Statvoo Rating
D
Estimated daily income
$461
Estimated monthly income
$14,022

Frequently Asked Questions (FAQ)

Q: When was Rivegauche.ru registered?
A: Rivegauche.ru was registered 20 years, 9 months, 8 hours, 8 minutes, 1 second ago on Tuesday, September 25, 2001.
Q: When was the WHOIS for Rivegauche.ru last updated?
A: The WHOIS entry was last updated 10 months, 5 days, 8 hours, 8 minutes, 1 second ago on Friday, August 20, 2021.
Q: What are Rivegauche.ru's nameservers?
A: DNS for Rivegauche.ru is provided by the following nameservers:
  • ns3-l2.nic.ru
  • ns4-cloud.nic.ru
  • ns4-l2.nic.ru
  • ns8-cloud.nic.ru
  • ns8-l2.nic.ru
Q: Who is the registrar for the Rivegauche.ru domain?
A: The domain has been registered at RU-CENTER-REG-RIPN.
Q: What is the traffic rank for Rivegauche.ru?
A: Rivegauche.ru ranks 45,766 globally on Alexa. Rivegauche.ru has a Low Trust Score, and a Statvoo Rank of D.
Q: How many people visit Rivegauche.ru each day?
A: Rivegauche.ru receives approximately 38,456 visitors and 230,736 page impressions per day.
Q: What IP address does Rivegauche.ru resolve to?
A: Rivegauche.ru resolves to the IPv4 address 52.136.245.19.
Q: In what country are Rivegauche.ru servers located in?
A: Rivegauche.ru has servers located in the Netherlands.
Q: What webserver software does Rivegauche.ru use?
A: Rivegauche.ru is powered by * webserver.
Q: Who hosts Rivegauche.ru?
A: Rivegauche.ru is hosted by MICROSOFT-CORP-MSN-AS-BLOCK in North Holland, Amsterdam, Netherlands, 1012.
Q: How much is Rivegauche.ru worth?
A: Rivegauche.ru has an estimated worth of $331,920. An average daily income of approximately $461, which is roughly $14,022 per month.

Rivegauche.ru Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Rivegauche.ru Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Rivegauche.ru

H1 Headings

0 :

H2 Headings

6 :
  1. БАДы и витамины
  2. Скидки в августе!
  3. Новинки
  4. Свежесть и прохлада
  5. Эксклюзивно онлайн
  6. Бестселлеры

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

204 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-49656586-1

Links - Internal

335:

Links - Internal (nofollow)

0:

Links - Outbound

8:

Links - Outbound (nofollow)

0:

Keyword Cloud for Rivegauche.ru

5in1haematococcusqqshowcasesqqcodeqqshowcasesnewqqnameqqqqmediaqqurlqqmedias6scnewpngcontextbwfzdgvyfgljb25zfdeymdd8aw1hz2uvcg5nfgljb25zl2g4oc9onwuvotyxotu4otkymjg0ni5wbmd8yzdlote2zwq3owvjnwm2nwfizjhlyzi4zddjnwrjmjrmywnhmjaznzflymuwntg2mzi2zgmzyzc5nje4mdczywqqcodeqqscnewqqurlqqcategoryshowcasesnewqqaddedtowishlistqfalseqbrandqqcodeqqrgbrand557qqnameqqcorinelinks columnqqcodeqqrivegaucheclassification10rggeneralcategoryforwhomqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategoryresultqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqqqcodeqqrghaircareqqnameqq qqfeaturesqqcodeqqrivegaucheclassification10rghaircareformhaircareqqnameqqcard slotbbadvancedthalgo agepngqqcatalogidqqrivegauchecontentcatalogqqcatalogversionqqonlineqqmimeqqimagepngqqalttextqqallegoriaqqshowcasesqqcodeqqshowcasesexclusiveqqnameqq qqmediaqqurlqqmedias6scexclusivepngcontextbwfzdgvyfgljb25zfdyzohxpbwfnzs9wbmd8awnvbnmvadkzl2gxys85nje5ntg5odi0ntqylnbuz3xmnthhzgm0mjfiyzbhn2ywzdljzdmyogm2y2e0y2zmyzq3ythhmjg2odk3yzzmmtg5nmjmmmjjmddmmji4owq4qqcodeqqscexclusiveqqurlqqcategoryshowcasesexclusiveqqcodeqqshowcasesofferqqnameqqqqmediaqqurlqqmedias6scofferpngcontextbwfzdgvyfgljb25zfdeymjf8aw1hz2uvcg5nfgljb25zl2gzmc9ozjevotyxotu4otg5mda3oc5wbmd8mzhlmmi1mmi0mguznjiyowqzownjnge2mgy4ogvjotvmnzblytgzytaxnzgxztcwowzlodrhnguxzdvkmwfhoaqqcodeqqscofferqqurlqqcategoryshowcasesofferqqcodeqqshowcasescomplimentqqnameqqeau de parfumcgiftqqtextqqfacialmakeupcare facebicncardqqrootcssclassqqbheaderlink dflex alignitemscenterqqlinknameqqnbsp corineqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq150qqcodeqqrivegaucheclassification10rggeneralcategorytypeqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategoryforwhomqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqt lliuva uvbspf30lbrgsunytol lbrg haematococcuslinkqqotherpropertiesqqcontainerqfalseqexternalqfalseqlinknameqqqqcodeqqrivegaucheclassification10rggeneralcategoryresultqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqqqcodeqqrghaircareqqnameqq qqfeaturesqqcodeqqrivegaucheclassification10rghaircareformhaircareqqnameqquva uvb lbrgcategoryqqfeaturesqqcodeqqrivegaucheclassification10rggeneralcategorymadeinqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqqqcodeqqrivegaucheclassification10rggeneralcategoryskintypeqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategoryvolumeqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq50qqcodeqqrivegaucheclassification10rggeneralcategorytypeqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategoryforwhomqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqlspanspf 20qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategoryvolumeqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq150qqcodeqqrivegaucheclassification10rggeneralcategorytypeqqnameqqherbalbodyqqcodeqqrivegaucheclassification10rggeneralcategoryskintypeqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategorytypeqqnameqqlbrg 100 lbrgspfclassqbfooterlistitemqglanbsp herbal herbalhtml unordereduvalliqqsubtitleqq qqshowcasesqqcodeqqshowcasesofferqqnameqqqqmediaqqurlqqmedias6scofferpngcontextbwfzdgvyfgljb25zfdeymjf8aw1hz2uvcg5nfgljb25zl2gzmc9ozjevotyxotu4otg5mda3oc5wbmd8mzhlmmi1mmi0mguznjiyowqzownjnge2mgy4ogvjotvmnzblytgzytaxnzgxztcwowzlodrhnguxzdvkmwfhoaqqcodeqqscofferqqurlqqcategoryshowcasesofferqqcodeqqshowcasescomplimentqqnameqqaquabicncardqqrootcssclassqqbheaderlinktravellinkqqotherpropertiesqqcontainerqfalseqexternalqfalseqiconcssclassqqbicn bicncardqqrootcssclassqqbheaderlinkhtml unordered listskingaucheunorderedaqua allegorialbrg lbrglbrglbgeau de toilettefirstcategoryqqfeaturesqqcodeqqrivegaucheclassification10rggeneralcategorymadeinqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategoryskintypeqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq2categoryqqfeaturesqqcodeqqrivegaucheclassification10rggeneralcategorymadeinqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqqqcodeqqrivegaucheclassification10rggeneralcategoryskintypeqqnameqq4rowprimerqqfeaturesqqcodeqqrivegaucheclassification10rghaircareformhaircareqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqlbrglbrgqqlabelqqsunscreen lotiondefense sunnbsp thalgolbrg 3defenselinks column slotqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategoryforwhomqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategoryresultqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqqqcodeqqrgtanningqqnameqqtanningqqfeaturesqqcodeqqrivegaucheclassification10rgtanningformtanningproductqqnameqqaftersunhydratingqqerrorqqlbglbrg 159qqcodeqqrivegaucheclassification10rggeneralcategoryvolumeqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq150qqcodeqqrivegaucheclassification10rggeneralcategorytypeqqnameqqface cream 5in1qqshowcasesqqcodeqqshowcasesnewqqnameqqqqmediaqqurlqqmedias6scnewpngcontextbwfzdgvyfgljb25zfdeymdd8aw1hz2uvcg5nfgljb25zl2g4oc9onwuvotyxotu4otkymjg0ni5wbmd8yzdlote2zwq3owvjnwm2nwfizjhlyzi4zddjnwrjmjrmywnhmjaznzflymuwntg2mzi2zgmzyzc5nje4mdczywqqcodeqqscnewqqurlqqcategoryshowcasesnewqqcodeqqshowcasescomplimentqqnameqqcremeqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq50qqcodeqqrivegaucheclassification10rggeneralcategorytypeqqnameqqlbrglbrglbg lbglbrg qqstockqqstocklevelstatusqqcodeqqinstockqqcodelowercaseqqinstockqqstocklevelstatusforposqqcodeqqoutofstockqqcodelowercaseqqoutofstockqqavailableforpickupqfalseqmanufacturerqqcorine8lli classqbfooterlistitemqglaerborian erboriancream 5in1 spfkenzodflex alignitemscenterqqlinknameqqqqcodeqqrivegaucheclassification10rggeneralcategoryforwhomqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategoryresultqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqqqcodeqqrghaircareqqnameqqnbsp thalgo thalgonbsp clarinsglamglowqqcodeqqrivegaucheclassification10rggeneralcategorytypeqqnameqqqqcodeqqrivegaucheclassification10rggeneralcategoryresultqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqqqcodeqqrgtanningqqnameqqtanningqqfeaturesqqcodeqqrivegaucheclassification10rgtanningformtanningproductqqnameqqcolumn htmlthalgo thalgopngqqdescriptionqqcorinerow slotlinkqqotherpropertiesqqcontainerqfalseqexternalqfalseqiconcssclassqqbicnwatersecond links columncolumn html unorderedformulaqqmediaqqurlqqmedias6scexclusivepngcontextbwfzdgvyfgljb25zfdyzohxpbwfnzs9wbmd8awnvbnmvadkzl2gxys85nje5ntg5odi0ntqylnbuz3xmnthhzgm0mjfiyzbhn2ywzdljzdmyogm2y2e0y2zmyzq3ythhmjg2odk3yzzmmtg5nmjmmmjjmddmmji4owq4qqcodeqqscexclusiveqqurlqqcategoryshowcasesexclusiveqqcodeqqshowcasesofferqqnameqqqqmediaqqurlqqmedias6scofferpngcontextbwfzdgvyfgljb25zfdeymjf8aw1hz2uvcg5nfgljb25zl2gzmc9ozjevotyxotu4otg5mda3oc5wbmd8mzhlmmi1mmi0mguznjiyowqzownjnge2mgy4ogvjotvmnzblytgzytaxnzgxztcwowzlodrhnguxzdvkmwfhoaqqcodeqqscofferqqurlqqcategoryshowcasesofferqqcodeqqshowcasescomplimentqqnameqqage defense sunnownbsp guerlainfarme aftersunsunqqcodeqqrivegaucheclassification10rggeneralcategoryresultqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqqqcodeqqrghaircareqqnameqq qqfeaturesqqcodeqqrivegaucheclassification10rghaircareformhaircareqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqqqstockqqstocklevelstatusqqcodeqqinstockqqcodelowercaseqqinstockqqstocklevelstatusforposqqcodeqqoutofstockqqcodelowercaseqqoutofstockqqavailableforpickupqfalseqmanufacturerqqcorine7qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategoryvolumeqqnameqqalignitemscenterqqlinknameqqnbsp drjartkeratinasesamecream 5in1lbrgsunytollinks column htmlqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategoryforwhomqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqhtmlnbsp herbalcomplexionlbrg lbrg lbrglbrglbg100 lbrgspfqqsubtitleqq qqshowcasesqqcodeqqshowcasesexclusiveqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategoryforwhomqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategoryresultqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqqqcodeqqrghaircareqqnameqqdflexspf 30farmeeau6qqsubtitleqqmattefarme sunscreennbsp erborian erborianlaglligprotectivecoolinggelmobilesecond1lbrglbrglbg lbglbrg lbrglbrglbgqqcodeqqrivegaucheclassification10rggeneralcategoryvolumeqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq150qqcodeqqrivegaucheclassification10rggeneralcategorytypeqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqqqcodeqqrivegaucheclassification10rggeneralcategoryvolumeqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq50qqcodeqqrivegaucheclassification10rggeneralcategorytypeqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqkitlbrg lbrglbrglbg lbglbrgninaqqcodeqqrivegaucheclassification10rggeneralcategoryforwhomqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategoryresultqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqqqcodeqqrgtanningqqnameqqtanningqqfeaturesqqcodeqqrivegaucheclassification10rgtanningformtanningproductqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqfarme corineqqcodeqqrivegaucheclassification10rggeneralcategoryresultqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqqqcodeqqrghaircareqqnameqqpayotguerlainqqcodeqqrivegaucheclassification10rggeneralcategoryforwhomqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq3lbglbrgfirst linkstfarme sunscreen lotioncolumn slotpngqqcatalogidqqrivegauchecontentcatalogqqcatalogversionqqonlineqqmimeqqimagepngqqalttextqq pngqqdescriptionqqsun body lotionlbrg5in1 spfhairthalgo thalgo agelbrg haematococcuscategoryqqfeaturesqqcodeqqrivegaucheclassification10rggeneralcategorymadeinqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqqqcodeqqrivegaucheclassification10rggeneralcategoryvolumeqqnameqqsunscreenqqcodeqqrivegaucheclassification10rggeneralcategoryvolumeqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq50qqcodeqqrivegaucheclassification10rggeneralcategorytypeqqnameqqqqfeaturesqqcodeqqrivegaucheclassification10rghaircareformhaircareqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rghaircarehairtypeqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq150qqcodeqqrivegaucheclassification10rggeneralcategorytypeqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqfirst links columnkeratinampsesamebb cream5in1 spf 20upnbsp nowqqcodeqqrivegaucheclassification10rghaircarehairtypeqqnameqqlbglbrg lbrglbrglbg lbglbrgcategoryqqfeaturesqqcodeqqrivegaucheclassification10rggeneralcategorymadeinqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategoryskintypeqqnameqqlbrglbrglbgcategoryqqfeaturesqqcodeqqrivegaucheclassification10rggeneralcategorymadeinqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqoilqqshowcasesqqcodeqqshowcasesexclusiveqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rghaircarehairtypeqqnameqqlbglbrg lbrg 100columneffectslotqqfeaturesqqcodeqqrivegaucheclassification10rghaircareformhaircareqqnameqqlbrgsunytol lbrgbamboomakeupcarehighroseqqcodeqqrivegaucheclassification10rggeneralcategoryskintypeqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqcarouselqqotherpropertiesqqcontainerqfalseqstatehandlerqqproductcarouselcomponenthandlerqqscrollqqoneqqcountqq4qqmobilecountq2qshowaddtocartbtnqfalseqtitleqqlbrgspfqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategoryvolumeqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq50qqcodeqqrivegaucheclassification10rggeneralcategorytypeqqnameqqqqcodeqqrivegaucheclassification10rggeneralcategoryskintypeqqnameqqglowlpglpgthalgolbrglbrglbg lbglbrglotionrepairbicncardqqrootcssclassqqbheaderlink dflexuvbparfumdrjartqqannotationqqlbrglbrglbg lbglbrg lbrgsecond linkslbglbrg lbrgunordered listface cream spfloyaltycard2 lbrgsunytolnarcisotoilettenbsp2 lbrgsunytol lbrgageloyalty cardqqtitleqqlinkqqotherpropertiesqqcontainerqfalseqexternalqfalseqiconcssclassqqbicn bicncardqqrootcssclassqqbheaderlink dflexmgnourishingnudeqqcodeqqrivegaucheclassification10rggeneralcategoryforwhomqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategoryresultqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqqqcodeqqrgtanningqqnameqqtanningqqfeaturesqqcodeqqrivegaucheclassification10rgtanningformtanningproductqqnameqqlbrg lbrgfarme protectiveqqshowcasesqqcodeqqshowcasesofferqqnameqqqqmediaqqurlqqmedias6scofferpngcontextbwfzdgvyfgljb25zfdeymjf8aw1hz2uvcg5nfgljb25zl2gzmc9ozjevotyxotu4otg5mda3oc5wbmd8mzhlmmi1mmi0mguznjiyowqzownjnge2mgy4ogvjotvmnzblytgzytaxnzgxztcwowzlodrhnguxzdvkmwfhoaqqcodeqqscofferqqurlqqcategoryshowcasesofferqqcodeqqshowcasescomplimentqqnameqqqqcodeqqrivegaucheclassification10rggeneralcategoryvolumeqqnameqqcreamkeratinampsesame oilfacebody lotionqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq150qqcodeqqrivegaucheclassification10rggeneralcategorytypeqqnameqqcardage defense0qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq50qqcodeqqrivegaucheclassification10rggeneralcategorytypeqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqclarinscream spfradiancecorine de farmehydranbsp erborianlbglbrg qqstockqqstocklevelstatusqqcodeqqinstockqqcodelowercaseqqinstockqqstocklevelstatusforposqqcodeqqoutofstockqqcodelowercaseqqoutofstockqqavailableforpickupqfalseqmanufacturerqqcorineuvb lbrgdefense sun bodyspfloyaltylbglbrg lbrglbrglbgloyalty card slotlbrg lbrg lbrgqqemailqqmaskcomplexlinkst lli classqbfooterlistitemqglalisterborianqqcodeqqrivegaucheclassification10rggeneralcategoryresultqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqqqcodeqqrgtanningqqnameqqtanningqqfeaturesqqcodeqqrivegaucheclassification10rgtanningformtanningproductqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqsun bodymoisturizerqqemptyqqface creamqqaddressqqmakeupcare face creamcentellacategoryqqfeaturesqqcodeqqrivegaucheclassification10rggeneralcategorymadeinqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqqqcodeqqrivegaucheclassification10rggeneralcategoryskintypeqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqbeautyqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategorytypeqqnameqq5lbrg 100thalgo age defenseserumherbal herbal

Longtail Keyword Density for Rivegauche.ru

KeywordsOccurences
corine de farme14
qqcodeqqrivegaucheclassification10rggeneralcategoryforwhomqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategoryresultqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqqqcodeqqrgtanningqqnameqqtanningqqfeaturesqqcodeqqrivegaucheclassification10rgtanningformtanningproductqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq12
qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategoryforwhomqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategoryresultqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqqqcodeqqrgtanningqqnameqqtanningqqfeaturesqqcodeqqrivegaucheclassification10rgtanningformtanningproductqqnameqq12
categoryqqfeaturesqqcodeqqrivegaucheclassification10rggeneralcategorymadeinqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqqqcodeqqrivegaucheclassification10rggeneralcategoryskintypeqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategoryvolumeqqnameqq12
qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq150qqcodeqqrivegaucheclassification10rggeneralcategorytypeqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategoryforwhomqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq10
t lli classqb-footerlist--itemqgla9
qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategoryvolumeqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq150qqcodeqqrivegaucheclassification10rggeneralcategorytypeqqnameqq8
qqcodeqqrivegaucheclassification10rggeneralcategoryvolumeqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq150qqcodeqqrivegaucheclassification10rggeneralcategorytypeqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq8
eau de toilette6
age defense sun6
lbrg lbrglbrglbg lbglbrg6
lbrglbrglbg lbglbrg lbrg6
lbrg lbrg lbrglbrglbg5
lbrg lbrg lbrg5
nbsp thalgo thalgo5
nbsp erborian erborian4
farme sunscreen lotion4
qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq50qqcodeqqrivegaucheclassification10rggeneralcategorytypeqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategoryforwhomqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq4
qqcodeqqrivegaucheclassification10rggeneralcategoryvolumeqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq50qqcodeqqrivegaucheclassification10rggeneralcategorytypeqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq4
qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategoryvolumeqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq50qqcodeqqrivegaucheclassification10rggeneralcategorytypeqqnameqq4
eau de parfum4
lbglbrg lbrglbrglbg lbglbrg4
lbrglbrglbg lbglbrg lbrglbrglbg4
thalgo age defense4
thalgo thalgo age4
face cream 5-in-14
defense sun body4
sun body lotion4
qqcodeqqrivegaucheclassification10rggeneralcategoryskintypeqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategorytypeqqnameqq4
categoryqqfeaturesqqcodeqqrivegaucheclassification10rggeneralcategorymadeinqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategoryskintypeqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq4
makeup-care face cream4
loyalty card slot3
linkqqotherpropertiesqqcontainerqfalseqexternalqfalseqiconcssclassqqb-icn b-icncardqqrootcssclassqqb-headerlink d-flex3
column html unordered3
first links column3
html unordered list3
lbrgsunytol lbrg haematococcus3
links column slot3
2 lbrgsunytol lbrg3
second links column3
links column html3
uva uvb lbrg3
lbrglbrglbg lbglbrg qqstockqqstocklevelstatusqqcodeqqinstockqqcodelowercaseqqinstockqqstocklevelstatusforposqqcodeqqoutofstockqqcodelowercaseqqoutofstockqqavailableforpickupqfalseqmanufacturerqqcorine3
lbrg 100 lbrgspf3
lbglbrg lbrg 1003
qqfeaturesqqcodeqqrivegaucheclassification10rghaircareformhaircareqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rghaircarehairtypeqqnameqq3
qqcodeqqrivegaucheclassification10rggeneralcategoryresultqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqqqcodeqqrghaircareqqnameqq qqfeaturesqqcodeqqrivegaucheclassification10rghaircareformhaircareqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq3
qqcodeqqrivegaucheclassification10rggeneralcategoryforwhomqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategoryresultqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqqqcodeqqrghaircareqqnameqq qqfeaturesqqcodeqqrivegaucheclassification10rghaircareformhaircareqqnameqq3
qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategoryforwhomqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategoryresultqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqqqcodeqqrghaircareqqnameqq3
5-in-1 spf 203
cream 5-in-1 spf3
face cream spf3
nbsp herbal herbal3
b-icncardqqrootcssclassqqb-headerlink d-flex align-items-centerqqlinknameqq3
lbrglbrglbg lbglbrg21
lli classqb-footerlist--itemqgla17
qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategoryforwhomqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq15
lbrg lbrg13
qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategoryvolumeqqnameqq12
categoryqqfeaturesqqcodeqqrivegaucheclassification10rggeneralcategorymadeinqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqqqcodeqqrivegaucheclassification10rggeneralcategoryskintypeqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq12
qqcodeqqrivegaucheclassification10rggeneralcategoryresultqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqqqcodeqqrgtanningqqnameqqtanningqqfeaturesqqcodeqqrivegaucheclassification10rgtanningformtanningproductqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq12
qqcodeqqrivegaucheclassification10rggeneralcategoryforwhomqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategoryresultqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqqqcodeqqrgtanningqqnameqqtanningqqfeaturesqqcodeqqrivegaucheclassification10rgtanningformtanningproductqqnameqq12
t lli10
qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq150qqcodeqqrivegaucheclassification10rggeneralcategorytypeqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq10
face cream10
defense sun8
links column8
qqcodeqqrivegaucheclassification10rggeneralcategoryvolumeqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq150qqcodeqqrivegaucheclassification10rggeneralcategorytypeqqnameqq8
age defense8
nbsp corine7
farme corine7
lbglbrg lbrg6
lbrg lbrglbrglbg6
nbsp erborian6
body lotion5
row slot5
nbsp thalgo5
thalgo thalgo5
thalgo age4
qqcodeqqrivegaucheclassification10rggeneralcategoryskintypeqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq4
qqcodeqqrivegaucheclassification10rggeneralcategoryvolumeqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq50qqcodeqqrivegaucheclassification10rggeneralcategorytypeqqnameqq4
aqua allegoria4
erborian erborian4
uva uvb4
lbglbrg lbrglbrglbg4
lbglbrg 154
farme sunscreen4
card slot4
sun body4
qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategorytypeqqnameqq4
sunscreen lotion4
categoryqqfeaturesqqcodeqqrivegaucheclassification10rggeneralcategorymadeinqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategoryskintypeqqnameqq4
farme after-sun4
makeup-care face4
cream 5-in-14
farme protective4
spf 304
qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq50qqcodeqqrivegaucheclassification10rggeneralcategorytypeqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq4
2 lbrgsunytol3
lbrgsunytol lbrg3
lbrg haematococcus3
html unordered3
lbglbrg qqstockqqstocklevelstatusqqcodeqqinstockqqcodelowercaseqqinstockqqstocklevelstatusforposqqcodeqqoutofstockqqcodelowercaseqqoutofstockqqavailableforpickupqfalseqmanufacturerqqcorine3
first links3
loyalty card3
column html3
linkqqotherpropertiesqqcontainerqfalseqexternalqfalseqiconcssclassqqb-icn b-icncardqqrootcssclassqqb-headerlink3
b-icncardqqrootcssclassqqb-headerlink d-flex3
column slot3
second links3
unordered list3
nbsp now3
100 lbrgspf3
pngqqcatalogidqqrivegauchecontentcatalogqqcatalogversionqqonlineqqmimeqqimagepngqqalttextqq pngqqdescriptionqq3
nbsp drjart3
nbsp clarins3
nbsp herbal3
herbal herbal3
keratinampsesame oil3
cream spf3
bb cream3
5-in-1 spf3
spf 203
qqsubtitleqq qqshowcasesqqcodeqqshowcasesofferqqnameqqqqmediaqqurlqqmedias6sc-offerpngcontextbwfzdgvyfgljb25zfdeymjf8aw1hz2uvcg5nfgljb25zl2gzmc9ozjevotyxotu4otg5mda3oc5wbmd8mzhlmmi1mmi0mguznjiyowqzownjnge2mgy4ogvjotvmnzblytgzytaxnzgxztcwowzlodrhnguxzdvkmwfhoaqqcodeqqscofferqqurlqqcategoryshowcasesofferqqcodeqqshowcasescomplimentqqnameqq3
lbrg 1003
qqsubtitleqq qqshowcasesqqcodeqqshowcasesexclusiveqqnameqq3
qqshowcasesqqcodeqqshowcasesexclusiveqqnameqq qqmediaqqurlqqmedias6sc-exclusivepngcontextbwfzdgvyfgljb25zfdyzohxpbwfnzs9wbmd8awnvbnmvadkzl2gxys85nje5ntg5odi0ntqylnbuz3xmnthhzgm0mjfiyzbhn2ywzdljzdmyogm2y2e0y2zmyzq3ythhmjg2odk3yzzmmtg5nmjmmmjjmddmmji4owq4qqcodeqqscexclusiveqqurlqqcategoryshowcasesexclusiveqqcodeqqshowcasesofferqqnameqqqqmediaqqurlqqmedias6sc-offerpngcontextbwfzdgvyfgljb25zfdeymjf8aw1hz2uvcg5nfgljb25zl2gzmc9ozjevotyxotu4otg5mda3oc5wbmd8mzhlmmi1mmi0mguznjiyowqzownjnge2mgy4ogvjotvmnzblytgzytaxnzgxztcwowzlodrhnguxzdvkmwfhoaqqcodeqqscofferqqurlqqcategoryshowcasesofferqqcodeqqshowcasescomplimentqqnameqq3
nbsp guerlain3
qqcodeqqrivegaucheclassification10rggeneralcategoryforwhomqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rggeneralcategoryresultqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqqqcodeqqrghaircareqqnameqq3
qqcodeqqrivegaucheclassification10rggeneralcategoryresultqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqqqcodeqqrghaircareqqnameqq qqfeaturesqqcodeqqrivegaucheclassification10rghaircareformhaircareqqnameqq3
qqfeaturesqqcodeqqrivegaucheclassification10rghaircareformhaircareqqnameqq qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq3
qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq qqcodeqqrivegaucheclassification10rghaircarehairtypeqqnameqq3
uvb lbrg3
lbrg 33
d-flex align-items-centerqqlinknameqq3
nbsp69
qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq50
lbrg45
qqsubtitleqq42
lbglbrg27
slot26
farme21
lbrglbrglbg21
eau20
sun18
lli18
classqb-footerlist--itemqgla17
cream15
qqcodeqqrivegaucheclassification10rggeneralcategoryforwhomqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq15
corine14
spf14
oil13
face12
categoryqqfeaturesqqcodeqqrivegaucheclassification10rggeneralcategorymadeinqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqqqcodeqqrivegaucheclassification10rggeneralcategoryskintypeqqnameqq12
qqcodeqqrivegaucheclassification10rggeneralcategoryvolumeqqnameqq12
qqcodeqqrivegaucheclassification10rggeneralcategoryresultqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqqqcodeqqrgtanningqqnameqqtanningqqfeaturesqqcodeqqrivegaucheclassification10rgtanningformtanningproductqqnameqq12
qqshowcasesqqcodeqqshowcasesexclusiveqqnameqq11
erborian11
qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq150qqcodeqqrivegaucheclassification10rggeneralcategorytypeqqnameqq10
thalgo10
lotion10
010
t10
defense10
links9
linkqqotherpropertiesqqcontainerqfalseqexternalqfalseqlinknameqq8
age8
18
column8
bb8
27
body7
37
qqshowcasesqqcodeqqshowcasesnewqqnameqqqqmediaqqurlqqmedias6sc-newpngcontextbwfzdgvyfgljb25zfdeymdd8aw1hz2uvcg5nfgljb25zl2g4oc9onwuvotyxotu4otkymjg0ni5wbmd8yzdlote2zwq3owvjnwm2nwfizjhlyzi4zddjnwrjmjrmywnhmjaznzflymuwntg2mzi2zgmzyzc5nje4mdczywqqcodeqqscnewqqurlqqcategoryshowcasesnewqqaddedtowishlistqfalseqbrandqqcodeqqrgbrand557qqnameqqcorine7
beauty7
lbrg-7
mask7
lbrglbrg6
repair6
d-flex6
herbal6
radiance6
sunscreen6
water6
skin6
toilette6
cooling6
aqua6
row5
glow5
matte5
45
parfum5
linkqqotherpropertiesqqcontainerqfalseqexternalqfalseqiconcssclassqqb-icn5
qqemptyqq5
lagllig5
qqmediaqqurlqqmedias6sc-exclusivepngcontextbwfzdgvyfgljb25zfdyzohxpbwfnzs9wbmd8awnvbnmvadkzl2gxys85nje5ntg5odi0ntqylnbuz3xmnthhzgm0mjfiyzbhn2ywzdljzdmyogm2y2e0y2zmyzq3ythhmjg2odk3yzzmmtg5nmjmmmjjmddmmji4owq4qqcodeqqscexclusiveqqurlqqcategoryshowcasesexclusiveqqcodeqqshowcasesofferqqnameqqqqmediaqqurlqqmedias6sc-offerpngcontextbwfzdgvyfgljb25zfdeymjf8aw1hz2uvcg5nfgljb25zl2gzmc9ozjevotyxotu4otg5mda3oc5wbmd8mzhlmmi1mmi0mguznjiyowqzownjnge2mgy4ogvjotvmnzblytgzytaxnzgxztcwowzlodrhnguxzdvkmwfhoaqqcodeqqscofferqqurlqqcategoryshowcasesofferqqcodeqqshowcasescomplimentqqnameqq5
55
uvb4
qqaddressqq4
qqtitleqq4
gel4
mg4
lpglpg4
uva4
allegoria4
formula4
qqcodeqqrivegaucheclassification10rggeneralcategorytypeqqnameqq4
64
qqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq50qqcodeqqrivegaucheclassification10rggeneralcategorytypeqqnameqq4
qqcodeqqrivegaucheclassification10rggeneralcategoryskintypeqqnameqq4
carouselqqotherpropertiesqqcontainerqfalseqstatehandlerqqproductcarouselcomponenthandlerqqscrollqqoneqqcountqq4qqmobilecountq2qshowaddtocartbtnqfalseqtitleqq4
categoryqqfeaturesqqcodeqqrivegaucheclassification10rggeneralcategorymadeinqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqq4
74
complexion4
lspan4
centella4
kenzo4
hair4
up4
primer4
spf304
protective4
after-sun4
facial4
advanced4
hydra4
card4
effect4
rose4
qqerrorqq4
hydrating4
c4
5-in-14
makeup-care4
lbrgspf3
haematococcus3
loyalty3
mobile3
html3
second3
qqcodeqqrivegaucheclassification10rghaircarehairtypeqqnameqq3
qqstockqqstocklevelstatusqqcodeqqinstockqqcodelowercaseqqinstockqqstocklevelstatusforposqqcodeqqoutofstockqqcodelowercaseqqoutofstockqqavailableforpickupqfalseqmanufacturerqqcorine3
loyaltycard3
unordered3
lbrgsunytol3
list3
b-icncardqqrootcssclassqqb-headerlink3
first3
moisturizer3
qqfeaturesqqcodeqqrivegaucheclassification10rghaircareformhaircareqqnameqq3
narciso3
kit3
glamglow3
clarins3
high3
drjart3
bamboo3
nina3
nourishing3
payot3
guerlain3
83
complex3
now3
travel-3
keratinampsesame3
gift3
qqcodeqqrivegaucheclassification10rggeneralcategoryresultqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqqqcodeqqrghaircareqqnameqq3
pngqqdescriptionqq3
categoryqqfeaturesqqcodeqqrivegaucheclassification10rggeneralcategorymadeinqqnameqqqqrangeqfalseqcomparableqtrueqfeaturevaluesqqvalueqqqqcodeqqrivegaucheclassification10rggeneralcategoryvolumeqqnameqq3
keratinasesame3
creme3
qqshowcasesqqcodeqqshowcasesnewqqnameqqqqmediaqqurlqqmedias6sc-newpngcontextbwfzdgvyfgljb25zfdeymdd8aw1hz2uvcg5nfgljb25zl2g4oc9onwuvotyxotu4otkymjg0ni5wbmd8yzdlote2zwq3owvjnwm2nwfizjhlyzi4zddjnwrjmjrmywnhmjaznzflymuwntg2mzi2zgmzyzc5nje4mdczywqqcodeqqscnewqqurlqqcategoryshowcasesnewqqcodeqqshowcasescomplimentqqnameqq3
qqshowcasesqqcodeqqshowcasesofferqqnameqqqqmediaqqurlqqmedias6sc-offerpngcontextbwfzdgvyfgljb25zfdeymjf8aw1hz2uvcg5nfgljb25zl2gzmc9ozjevotyxotu4otg5mda3oc5wbmd8mzhlmmi1mmi0mguznjiyowqzownjnge2mgy4ogvjotvmnzblytgzytaxnzgxztcwowzlodrhnguxzdvkmwfhoaqqcodeqqscofferqqurlqqcategoryshowcasesofferqqcodeqqshowcasescomplimentqqnameqq3
gauche3
pngqqcatalogidqqrivegauchecontentcatalogqqcatalogversionqqonlineqqmimeqqimagepngqqalttextqq3
serum3
qqlabelqq3
qqannotationqq3
93
qqemailqq3
qqtextqq3
nude3
align-items-centerqqlinknameqq3

Who hosts Rivegauche.ru?

Rivegauche.ru Hosting Provider Information

Hosted IP Address:52.136.245.19
Hosted Hostname:52.136.245.19
Service Provider:MICROSOFT-CORP-MSN-AS-BLOCK
Hosted Country:NetherlandsNL
Location Latitude:52.3759
Location Longitude:4.8975
Webserver Software:*

Is "MICROSOFT-CORP-MSN-AS-BLOCK" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
21.6445%
GOOGLE
14.1050%
AS-26496-GO-DADDY-COM-LLC
3.4726%
NAMECHEAP-NET
3.1524%
AMAZON-AES
2.2226%
GoDaddy.com, LLC
2.0265%
UNIFIEDLAYER-AS-1
1.9734%
Fara Negar Pardaz Khuzestan
1.6251%
CONFLUENCE-NETWORK-INC
1.4696%
AMAZON-02
1.3660%
MICROSOFT-CORP-MSN-AS-BLOCK
0.1463%

HTTP Header Analysis for Rivegauche.ru

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 20 Aug 2021 21:19:05 GMT
Server: *
Strict-Transport-Security: max-age=15724800
Content-Type: text/html; charset=utf-8
X-Powered-By: Express
ETag: W/"b8765-Xd4xYIRou1rtDC62yEqtEtyjK7s"
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
X-Content-Type-Options: nosniff
Transfer-Encoding: chunked

Rivegauche.ru Domain Nameserver Information

HostIP AddressCountry
ns3-l2.nic.ru 193.232.146.1
ns4-cloud.nic.ru 89.104.93.34
ns4-l2.nic.ru 91.217.20.20
ns8-cloud.nic.ru 89.104.95.36
ns8-l2.nic.ru 91.217.21.20


Need to find out who hosts Rivegauche.ru?


Domain Registration (WhoIs) information for Rivegauche.ru

 % By submitting a query to RIPN's Whois Service
% you agree to abide by the following terms of use:
% http://www.ripn.net/about/servpol.html#3.2 (in Russian)
% http://www.ripn.net/about/en/servpol.html#3.2 (in English).

domain: RIVEGAUCHE.RU
nserver: ns3-l2.nic.ru.
nserver: ns4-cloud.nic.ru.
nserver: ns4-l2.nic.ru.
nserver: ns8-cloud.nic.ru.
nserver: ns8-l2.nic.ru.
state: REGISTERED, DELEGATED, VERIFIED
org: LLC 'AromaLux'
registrar: RU-CENTER-RU
admin-contact: https://www.nic.ru/whois
created: 2001-09-25T20:00:00Z
paid-till: 2021-09-26T21:00:00Z
free-date: 2021-10-28
source: TCI

Last updated on 2021-05-07T08:46:30Z

Websites with Similar Names

Rivega.mx
Compra, renta, vende la casa de tus sueños en México, somos la mejor empresa de bienes raíces en Mazatlán - Rivega
Rivegauche-rivedroite.com
张北玻璃营运部
Rivegauche.info
www.rivegauche.info
Rivegauche.ru
РИВ ГОШ - Магазин парфюмерии и косметики
Rivegauche.shop
РИВ ГОШ - Магазин парфюмерии и косметики
Rivegauche24.com
Rivegauche24
Rivegauchedesign.net
rivegauchedesign.net
Rivegauchegalleries.com
Original Affordable Fine Art

Recently Updated Websites

Nailcandy.vip (8 seconds ago.)Penumbralapelicula.com (8 seconds ago.)Ehub54.webhostinghub.com (9 seconds ago.)Charm4everhomes.com (10 seconds ago.)Prozoretz.com (12 seconds ago.)American-giant.com (13 seconds ago.)Sirius.eventmaster.ie (14 seconds ago.)Giantgate.com (17 seconds ago.)Aboveaverage.com (18 seconds ago.)Hospitalitytrainingcentre.com (20 seconds ago.)Premierroofingca.com (20 seconds ago.)Hyp3r.com (24 seconds ago.)Realconfeito.com (24 seconds ago.)Decembeard2017.everydayhero.com (27 seconds ago.)Monmagan.org (27 seconds ago.)Sflw.org (27 seconds ago.)Paranaturismo.com.ar (31 seconds ago.)Talkatoo.com (32 seconds ago.)Lordofthewingsva.com (32 seconds ago.)Okiemplecaczka.pl (33 seconds ago.)Mitchharwood.net (37 seconds ago.)Media.godaddy.com (39 seconds ago.)Deltacommunitycu.com (39 seconds ago.)Arabsaustralia.com (40 seconds ago.)Fitness-and-finance.com (42 seconds ago.)Worldsoffun.com (43 seconds ago.)Trevorfitzgerald.com (43 seconds ago.)Hominemallorca.com (47 seconds ago.)Mobirise.info (47 seconds ago.)Mysdpc.org (47 seconds ago.)

Recently Searched Keywords

itsmwx (1 second ago.)0 borderrgba242 (1 second ago.)derksen (1 second ago.)黑夜弥天 (2 seconds ago.)gwarancja i serwis (2 seconds ago.)96px (3 seconds ago.)theo-de (3 seconds ago.)باشگاه پرسپولیس (3 seconds ago.)price 1400 regular (4 seconds ago.)ultimi articoli (4 seconds ago.)ve deme bilgileri (5 seconds ago.)solutions for everyone (5 seconds ago.)hng nbsp loa (6 seconds ago.)evikea (6 seconds ago.)jon klassen (7 seconds ago.)circular true infinite (7 seconds ago.)level controls (8 seconds ago.)reusable face mask - black$2.48 - $2.87 (8 seconds ago.)fat pussy (9 seconds ago.)restaurant menu card (9 seconds ago.)website design and marketing (9 seconds ago.)vrl (9 seconds ago.)bestellen spiel (10 seconds ago.)boris v ken (11 seconds ago.)400 flexslider--1478800373635 flex-caption (11 seconds ago.)knowledges (11 seconds ago.)合肥家具厂 (11 seconds ago.)popular wordpress (11 seconds ago.)story (12 seconds ago.)pm session (12 seconds ago.)