Rivington.net Favicon Rivington.net

Rivington.net Website Thumbnail
Checking...
MSN UK: Latest news, weather, Hotmail sign in, Outlook email, Bing
Low trust score
Add a review Change category Claim this site
Read today's top stories news, weather, sport, entertainment, lifestyle, money, cars and more, all expertly curated from across top UK and global news providers


Domain summary

Domain label
rivington
Domain extension
net
Domain registered:
2003-10-22
Domain updated:
2018-09-21
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is rivington.net ranked relative to other sites:

Percentage of visits to rivington.net from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Rivington.net registered?
A: Rivington.net was registered 16 years, 11 months, 6 days, 6 hours, 2 minutes, 42 seconds ago on Wednesday, October 22, 2003.
Q: When was the WHOIS for Rivington.net last updated?
A: The WHOIS entry was last updated 2 years, 1 week, 6 hours, 2 minutes, 42 seconds ago on Friday, September 21, 2018.
Q: What are Rivington.net's nameservers?
A: DNS for Rivington.net is provided by the following nameservers:
  • ns1.domaindirect.com
  • ns2.domaindirect.com
  • ns3.domaindirect.com
Q: Who is the registrar for the Rivington.net domain?
A: The domain has been registered at TUCOWS DOMAINS INC..
Q: What is the traffic rank for Rivington.net?
A: Rivington.net has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Rivington.net each day?
A: Rivington.net receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Rivington.net resolve to?
A: Rivington.net resolves to the IPv4 address 64.98.145.30.
Q: In what country are Rivington.net servers located in?
A: Rivington.net has servers located in the Canada.
Q: What webserver software does Rivington.net use?
A: Rivington.net is powered by webserver.
Q: Who hosts Rivington.net?
A: Rivington.net is hosted by Tucows.com Co. in Canada.
Q: How much is Rivington.net worth?
A: Rivington.net has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Rivington.net?

Rivington.net Hosting Provider Information

Hosted IP Address:64.98.145.30
Hosted Hostname:url.hover.com
Service Provider:Tucows.com Co.
Hosted Country:CanadaCA
Location Latitude:43.6319
Location Longitude:-79.3716
Webserver Software:Not Applicable

Is "Tucows.com Co." in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Rivington.net

Http-Version: 1.1
Status-Code: 302
Status: 302 Found
Cache-Control: no-cache, no-store, no-transform
Pragma: no-cache
Content-Length: 143
Content-Type: text/html; charset=utf-8
Expires: -1
Location: https://www.msn.com/en-gb/
Vary: User-Agent
Access-Control-Allow-Origin: *
X-AspNetMvc-Version: 5.2
X-AppVersion: 20200909_26914858
X-Activity-Id: 3d415b8c-7b35-45e6-9b08-f8f99111b3e6
X-Az: {did:951b20c4cd6d42d29795c846b4755d88, rid: 0, sn: neurope-prod-hp, dt: 2020-09-04T04:54:39.7742783Z, bt: 2020-09-09T21:16:23.2910113Z}
nel: {"report_to":"network-errors","max_age":604800,"success_fraction":0.001,"failure_fraction":1.0}
report-to: {"group":"network-errors","max_age":604800,"endpoints":[{"url":"https://deff.nelreports.net/api/report?cat=msn"}]}
X-UA-Compatible: IE=Edge;chrome=1
X-Content-Type-Options: nosniff
X-FRAME-OPTIONS: SAMEORIGIN
X-Powered-By: ASP.NET
Access-Control-Allow-Methods: HEAD,GET,OPTIONS
X-XSS-Protection: 1
X-MSEdge-Ref: Ref A: 3D415B8C7B3545E69B08F8F99111B3E6 Ref B: LON04EDGE0415 Ref C: 2020-09-10T16:53:25Z
Date: Thu, 10 Sep 2020 16:53:24 GMT

Rivington.net Domain Nameserver Information

HostIP AddressCountry
ns1.domaindirect.com 216.40.47.26
ns2.domaindirect.com 64.98.148.13
ns3.domaindirect.com 64.98.148.13


Need to find out who hosts Rivington.net?


WhoIs information for Rivington.net

 Domain Name: RIVINGTON.NET
Registry Domain ID: 105454076_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.tucows.com
Registrar URL: http://www.tucows.com
Updated Date: 2018-09-21T20:55:58Z
Creation Date: 2003-10-22T20:28:45Z
Registry Expiry Date: 2023-10-22T20:28:45Z
Registrar: Tucows Domains Inc.
Registrar IANA ID: 69
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS1.DOMAINDIRECT.COM
Name Server: NS2.DOMAINDIRECT.COM
Name Server: NS3.DOMAINDIRECT.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2020-08-04T23:13:01Z

Rivington.net Free SEO Report

Website Inpage Analysis for Rivington.net

H1 Headings

0 :

H2 Headings

19 :
  1. Portals Navigation
  2. Receive your emails here
  3. Latest Stories
  4. News
  5. Entertainment
  6. Sport
  7. Recommended for you
  8. Money
  9. Lifestyle
  10. Property
  11. Health & Fitness
  12. Food & Drink
  13. Travel
  14. Cars
  15. Photos
  16. Video
  17. Shopping
  18. Send MSN Feedback
  19. We appreciate your input!

H3 Headings

130 :
  1. Outlook.com
  2. eBay
  3. Office
  4. OneNote
  5. Amazon
  6. Skype
  7. OneDrive
  8. Maps
  9. Facebook
  10. Twitter
  11. Sign in with any Microsoft account: Outlook, Hotmail, MSN, Live
  12. Shop eBay Daily Deals
  13. Up to 60% Off Smartphones
  14. Best Tech Deals on eBay
  15. Gift Cards
  16. Amazon Marketplace
  17. Amazon Prime
  18. Today's Deals
  19. Gift Cards
  20. Facebook
  21. TOP STORIES
  22. DAME DIANA (1938-2020)
  23. NEWS
  24. REVIEWS
  25. UK’s largest care home operator faces damages claims over Covid-19 deaths
  26. EasyJet cuts 60 pilots but avoids mass cull as it closes three bases
  27. Phillip Schofield quizzes Jenny Harries over 'confusing' contrast in coronavirus rules
  28. Amanda Kloots discusses single parent struggles after Nick Cordero's death: 'It's okay to ask for he
  29. Belgium to return tooth to family of assassinated independence leader
  30. Confusion over 'COVID marshals' who will have no power to fine or arrest
  31. EU tells UK: drop Brexit plans to break law or face sanctions
  32. What is Operation Moonshot and is Boris Johnson's Covid testing plan feasible?
  33. The Third Day – watch the new Jude Law and Naomie Harris thriller
  34. LSO/Rattle review – Turnage, Knussen and Britten make an evening to be savoured
  35. The Roads Not Taken review: Sally Potter’s dementia drama is rich with intimacy, if not answers
  36. Khloe Kardashian responds to fake KUWTK announcement
  37. These movies made us cry our eyes out
  38. Doves: The Universal Want review – soaring soundtrack to changing lives
  39. The Fresh Prince of Bel-Air 30th anniversary: Where are the cast now?
  40. Stars turning 70 in 2020
  41. Nobody told me anything - Perez surprised by Racing Point axe and Vettel move
  42. Everton future transfer plans, trophy desire and every word from Carlo Ancelotti and James Rodriguez
  43. Micky Mellon in Lawrence Shankland transfer quip as Dundee United boss declares striker fit to face
  44. Premier League players to wear No Room For Racism sleeve badge throughout 2020/21 season
  45. Haas considering "close to 10" drivers for 2021 F1 seats
  46. Liverpool starlet 'could return to Swansea', Hull City set for Man United payout, Celtic rival Crystal Palace for £5m QPR winger - Championship Rumours
  47. Man City legend Vincent Kompany admits dreadful first impression of Kevin De Bruyne
  48. 'Amazing' - Aitor Karanka on Aston Villa star and Birmingham City's striker search
  49. Match the letters to the numbers to crack the code
  50. Stop Wasting Money – This Tool Finds Every Voucher Code Online
  51. Johnson's hard Brexit is about to deliver a devastating hit to our Covid-struck economy
  52. Exclusive: ECB governors agreed to look through euro rise - sources
  53. Hollywood's inclusion problems still run deep, study finds
  54. Two in five Brits working from home at risk of cyber attacks
  55. Citigroup becomes first big Wall Street bank to be run by female CEO
  56. The Savoy prepares to reopen its doors later this month
  57. Lloyd's of London expects £5bn in Covid-19 insurance payouts
  58. Pound dives as EU threatens UK over Internal Market Bill
  59. Japan's Suga: Will have to call for sales tax hike in future
  60. Private jet flights soar back as commercial recovery lags
  61. Various Eateries circles struggling competitors
  62. Singapore Airlines to cut 4,300 jobs due to pandemic
  63. Revealed: Ex-Goldman bankers plotted £375m Saga takeover bid
  64. The jobs that take the longest to fill — and might be easier to get
  65. FTSE 100 edges into the green as Wall Street opens higher
  66. ECB leaves interest rates on hold as it monitors recovery
  67. HALF of final salary pension transfers since Covid-19 outbreak have tell-tale signs savers are being scammed, warn fraud experts
  68. Bring in airport testing by end of the month or risk 'ruin'
  69. Why do some face masks have valves and why are they being banned?
  70. Love Island's Kendall Rae Knight admits to suffering through painful acne battle – but cleared break
  71. 8 of the best Breton tops to buy now for autumn
  72. Kerry Katona's fiancé Ryan reveals her children helped him pick ring
  73. Aldi's £80 scalloped velvet chair is back by popular demand
  74. Tried and tested: is the Pat McGrath x Supreme lipstick worth the hype?
  75. Reese Witherspoon celebrates lookalike daughter Ava Phillippe's 21st birthday with Instagram photos
  76. Vogue Williams effortlessly nails two of the biggest autumn trends
  77. Gemma Collins surprises fans in the most flattering skinny jeans
  78. Princess Anne has watched The Crown but mocks actress playing her for taking two hours to perfect ha
  79. Former golf centre to be bulldozed to make way for 800 new homes
  80. Plans for 70 houses and flats former hospital site in Merthyr
  81. Roath Park four bedroom bungalow which comes with a massive garden complete with babbling brook
  82. Brits spend over £3,500 on hidden 'extra' costs of moving home
  83. Freedom of movement - how can we work together to make running more diverse?
  84. Best treadmills: 9 top running machines for working out inside
  85. Coronavirus: Oxford vaccine trial ‘to resume in days’ after side-effect checks
  86. Coronavirus tips: Should you take paracetamol rather than ibuprofen to treat symptoms?
  87. Coronavirus: What is the difference between Covid-19 and the common cold and flu?
  88. Kayla Itsines' arms and abs workout to help improve your posture
  89. ‘My anxiety skyrocketed’: How lockdown has impacted mental health
  90. 7 Lyme Disease Symptoms That Are Way Too Easy to Ignore
  91. Zizzi unveils new pizza range which you can buy in Sainsbury’s from £4
  92. Our Favourite Alcoholic Advent Calendars Available To Pre-Order Now
  93. There’s A Way To Get 48 Days Off Next Year Using Just 19 Days Of Your Annual Leave
  94. Pumpkin Patch Brownies Are The Easiest Fall Dessert EVER
  95. Pumpkin Patch Brownies Use A Genius Decorating Hack
  96. Pumpkin Pie Punch Has Everything You Want For Fall
  97. Pumpkin Pie Punch
  98. You Need To See How These Edible Jack-O'-Lantern Bowls Are Made
  99. Canada's most beautiful lakes with turquoise waters, shipwrecks and even glaciers
  100. Working virtually? Swap skyrises for ocean views, says Bermuda
  101. Incredible tourist attractions that no longer exist
  102. Paris Hilton weighs in on Britney Spears’ conservatorship
  103. Airlines continue to split up households and families on flights despite pandemic
  104. Coronavirus: Blackpool loses planned express connection to London
  105. 10 of the best paddleboarding destinations in the UK - and where to stay
  106. Flight cancelled after child refuses to wear mask
  107. Suzuki Jimny back in Europe as two-seater commercial vehicle
  108. More than 1 in 3 new car buyers now choose automatic
  109. Amazing barn-find Audi quattro for sale
  110. Used Alfa Romeo Giulia review
  111. Delays on the M4 after lorry spills three tons of pilau rice
  112. 2022 Maserati Grecale SUV will be available as electric Folgore model
  113. New 'T' plates for young drivers could reduce accidents and take pressure off the roads
  114. Greatest machines with 100 horsepower or less
  115. The worst car names of all time
  116. Beautiful places you won't believe are in the UK
  117. 10 one-year wonders
  118. Greatest machines with 100 horsepower or less
  119. Crutches challenge...
  120. Kaley Cuoco claps back at mask shamers after sharing workout clip
  121. CLARET & BLUE- We've seen strikers come in for big money in the past and not get the service, it's v
  122. Golf carts race ends badly
  123. What schools must do if a pupil or staff member tests positive for Covid-19
  124. Hedwig, is that you?
  125. The Karanka answer that confirms Blues are after a striker and hints towards Jutkiewicz staying at t
  126. Cats vs Donald Trump
  127. Introducing Echo Flex | Voice control smart home devices with Alexa
  128. All-new Echo Dot (3rd Gen) | Improved sound & a new design
  129. Fire TV Stick 4K Ultra HD with Alexa Voice Remote | Save £10
  130. Introducing Echo Show 8 | 8" HD smart display with Alexa | Save £30

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

2 :

Total Images

317 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

233:
  1. msn refresh page
    http://rivington.net/en-gb
  2. msn
    http://rivington.net/en-gb
  3. CORONAVIRUS
    http://rivington.net/en-gb/news/coronavirus
  4. London / 19°C
    http://rivington.net/en-gb/weather/today/London,London,United-Kingdom/we-city?iso=GB&el=osrbpaviG%2B%2FoweH%2Fp%2FyjCw%3D%3D
  5. NEWS
    http://rivington.net/en-gb/news
  6. WEATHER
    http://rivington.net/en-gb/weather
  7. ENTERTAINMENT
    http://rivington.net/en-gb/entertainment
  8. SPORT
    http://rivington.net/en-gb/sport
  9. MONEY
    http://rivington.net/en-gb/money
  10. LIFESTYLE
    http://rivington.net/en-gb/lifestyle
  11. HOROSCOPES
    http://rivington.net/en-gb/lifestyle/horoscopes
  12. HEALTH & FITNESS
    http://rivington.net/en-gb/health
  13. FOOD & DRINK
    http://rivington.net/en-gb/foodanddrink
  14. CARS
    http://rivington.net/en-gb/cars
  15. TRAVEL
    http://rivington.net/en-gb/lifestyle/travel
  16. LIVE: Portugal out of exemption list Evening Standard
    http://rivington.net/en-gb/news/uknews/uk-coronavirus-live-cases-up-43-per-cent-in-highest-jump-since-may-as-uni-students-urged-not-to-share-virus-in-bedrooms/ar-BB18T4B0?li=BBoPWjQ
  17. EU threatens legal action over bill The Independent
    http://rivington.net/en-gb/news/brexit/brexit-eu-will-not-be-shy-in-taking-legal-steps-against-uk-and-says-boris-johnsons-draft-bill-endangers-irish-peace-deal/ar-BB18U1G1?li=BBoPWjQ
  18. Covid test seekers 'may be ranked' The Guardian
    http://rivington.net/en-gb/news/coronavirus/covid-test-seekers-may-be-ranked-by-priority-says-matt-hancock/ar-BB18Ud6q?li=BBoPWjQ
  19. Actress Dame Diana Rigg has died at the age of 82 The Telegraph
    http://rivington.net/en-gb/news/uknews/dame-diana-rigg-has-died-at-the-age-of-82/ar-BB18TZbU?li=BBoPWjQ
  20. 'Be a dragon': Diana Rigg remembered in tributes HuffPost UK
    http://rivington.net/en-gb/entertainment/celebritynews/dame-diana-rigg-remembered-in-tributes-from-game-of-thrones-and-james-bond-co-stars/ar-BB18U52a?li=BBoPWjQ
  21. Assange hearing paused over Covid The Guardian
    http://rivington.net/en-gb/news/courts/julian-assange-hearing-paused-for-lawyer-to-get-covid-test/ar-BB18TJsU?li=BBoPWjQ
  22. Fire at Beirut port month after blast The Washington Post
    http://rivington.net/en-gb/news/world/traumatized-beirut-watches-new-fire-burn-at-the-port-one-month-after-deadly-blast/ar-BB18TC1k?li=BBoPWjQ
  23. Scotland set to have 'rule of six' Mirror
    http://rivington.net/en-gb/news/coronavirus/scotland-to-have-coronavirus-rule-of-six-but-with-kids-exempt-as-r-soars-to-15/ar-BB18TpAr?li=BBoPWjQ
  24. Mulan review: Nothing more than a nationalist drama The Independent
    http://rivington.net/en-gb/entertainment/movies/mulan-is-nothing-more-than-a-nationalist-drama-that-whitewashes-the-uighur-muslim-crisis-in-china/ar-BB18Tsxi?li=BBoPWjQ
  25. Mary Berry’s Simple Comforts 'is not comforting' The Telegraph
    http://rivington.net/en-gb/entertainment/tv/mary-berrys-simple-comforts-review-neither-simple-nor-comforting/ar-BB18S0Ze?li=BBoPWjQ
  26. US Open 2020 men's final: what time does it start, what TV channel is it on and what are the odds? The Telegraph
    http://rivington.net/en-gb/sport/tennis/us-open-2020-mens-final-what-time-does-it-start-what-tv-channel-is-it-on-and-what-are-the-odds/ar-BB18TC3g?li=BBoPWjQ
  27. Coronavirus contact tracing hits new low - just as new cases soar Mirror
    http://rivington.net/en-gb/news/uknews/coronavirus-contact-tracing-hits-new-low-just-as-new-cases-soar/ar-BB18TDX0?li=BBoPWjQ
  28. Women in England struggling to access contraception as result of underfunding The Guardian
    http://rivington.net/en-gb/news/uknews/women-in-england-struggling-to-access-contraception-as-result-of-underfunding/ar-BB18TUAB?li=BBoPWjQ
  29. Three dead as US wildfires rage The Independent
    http://rivington.net/en-gb/news/world/california-wildfires-three-dead-as-blaze-continues/ar-BB18SMrg?li=BBoPWjQ
  30. Revealed: The advice given to universities on how to deal with COVID outbreaks Sky News
    http://rivington.net/en-gb/news/uknews/revealed-the-advice-given-to-universities-on-how-to-deal-with-covid-outbreaks/ar-BB18TT6N?li=BBoPWjQ
  31. Interim report on Stonehaven crash Sky News
    http://rivington.net/en-gb/news/uknews/stonehaven-crash-report-finds-network-rail-cant-afford-to-fix-all-similar-issues/ar-BB18TQJS?li=BBoPWjQ
  32. Coronavirus: Tory MP says government must ‘get a grip’ of testing and should not blame public The Independent
    http://rivington.net/en-gb/news/uknews/coronavirus-tory-mp-says-government-must-get-a-grip-of-testing-and-should-not-blame-public/ar-BB18TKE2?li=BBoPWjQ
  33. Rolling quarantines will cost the UK '87,000 more jobs this year' The Telegraph
    http://rivington.net/en-gb/news/uknews/rolling-quarantines-will-cost-the-uk-87000-more-jobs-this-year/ar-BB18TtZe?li=BBoPWjQ
  34. 'Moonshot' plan to increase testing The Telegraph
    http://rivington.net/en-gb/news/coronavirus/governments-moonshot-programme-aims-to-increase-coronavirus-testing-to-10-million-a-day/ar-BB18S19i?li=BBoPWjQ
  35. Captain Sir Tom Moore tells junior soldiers ‘the world is your oyster’ PA Media
    http://rivington.net/en-gb/news/uknews/captain-sir-tom-moore-tells-junior-soldiers-the-world-is-your-oyster/ar-BB18U5gx?li=BBoPWjQ
  36. Legoland's Halloween event is back for 2020 complete with a spooky new attraction Mirror
    http://rivington.net/en-gb/news/world/legolands-halloween-event-is-back-for-2020-complete-with-a-spooky-new-attraction/ar-BB18TtOv?li=BBoPWjQ
  37. New Covid plan for England could confine university students to halls The Guardian
    http://rivington.net/en-gb/news/uknews/new-covid-plan-for-england-could-confine-university-students-to-halls/ar-BB18TKfE?li=BBoPWjQ
  38. Sturgeon announces limits on gatherings Sky News
    http://rivington.net/en-gb/news/world/sturgeon-announces-limits-on-gatherings/vi-BB18TYkX
  39. Coronavirus: People should ‘hesitate’ before rush back to the office, says Professor Neil Ferguson The Independent
    http://rivington.net/en-gb/news/uknews/coronavirus-people-should-hesitate-before-rush-back-to-the-office-says-professor-neil-ferguson/ar-BB18TYQD?li=BBoPWjQ
  40. Trade war with Britain is EU's last resort if UK reneges on Brexit treaty The Telegraph
    http://rivington.net/en-gb/news/brexit/trade-war-with-britain-is-eus-last-resort-if-uk-reneges-on-brexit-treaty/ar-BB18TBJT?li=BBoPWjQ
  41. NHS's own helpline staff were told to give people tests even if they didn't have symptoms Mirror
    http://rivington.net/en-gb/news/uknews/nhss-own-helpline-staff-were-told-to-give-people-tests-even-if-they-didnt-have-symptoms/ar-BB18Twz1?li=BBoPWjQ
  42. Why I’d never place a bet on when gigs and music festivals will return The Independent
    http://rivington.net/en-gb/entertainment/music/why-id-never-place-a-bet-on-when-gigs-and-music-festivals-will-return/ar-BB18U1t8?li=BBoPWjQ
  43. New Girl's Lamorne Morris reveals what to expect from "brilliant" new series Digital Spy (UK)
    http://rivington.net/en-gb/entertainment/news/new-girls-lamorne-morris-reveals-what-to-expect-from-brilliant-new-series/ar-BB18U6SR?li=BBoPWjQ
  44. The longest celebrity engagements of all time Hello!
    http://rivington.net/en-gb/entertainment/celebrity/the-longest-celebrity-engagements-of-all-time/ss-BB18U6B9?li=BBoPWjQ
  45. Can you guess the movie from this group of objects? QuipoQuiz
    http://rivington.net/en-gb/entertainment/movies/can-you-guess-the-movie-from-this-group-of-objects/ss-BB18U4qO?li=BBoPWjQ
  46. Sam Thompson and Zara McDermott ‘SPLIT’ after 16 months Heatworld
    http://rivington.net/en-gb/lifestyle/relationships/sam-thompson-and-zara-mcdermott-split-after-16-months/ar-BB18U9FY?li=BBoPWjQ
  47. 20 affordable wedding dresses to consider for your big day Harper's Bazaar (UK)
    http://rivington.net/en-gb/lifestyle/wedding/20-affordable-wedding-dresses-to-consider-for-your-big-day/ss-BB17V8yZ?li=BBoPWjQ
  48. Molly-Mae Hague left visibly shaken as men shout vile abuse at her in the street during shopping spree OK!
    http://rivington.net/en-gb/lifestyle/style/molly-mae-hague-left-visibly-shaken-as-men-shout-vile-abuse-at-her-in-the-street-during-shopping-spree/ar-BB18U1S1?li=BBoPWjQ
  49. 15 of the best beauty organisers Harper's Bazaar (UK)
    http://rivington.net/en-gb/lifestyle/style/15-of-the-best-beauty-organisers/ss-BB18U8eo?li=BBoPWjQ
  50. Daniel Levy hoped 8,000 fans could have been present for Spurs' first game of new season The Telegraph
    http://rivington.net/en-gb/sport/premier-league/daniel-levy-hoped-8000-fans-could-have-been-present-for-spurs-first-game-of-new-season/ar-BB18TnJD?li=BBoPWjQ
  51. UK looks to Belgium for Covid inspiration despite infections rise The Guardian
    http://rivington.net/en-gb/news/world/uk-looks-to-belgium-for-covid-inspiration-despite-infections-rise/ar-BB18TEVA?li=BBoPWjQ
  52. Scotland Covid rules: Children under 12 to be exempt from 'rule of six' restriction The Independent
    http://rivington.net/en-gb/news/uknews/scotland-covid-rules-children-under-12-to-be-exempt-from-rule-of-six-restriction/ar-BB18TTJx?li=BBoPWjQ
  53. What would a no-deal Brexit do to the economy on top of Covid-19? The Telegraph
    http://rivington.net/en-gb/money/news/what-would-a-no-deal-brexit-do-to-the-economy-on-top-of-covid-19/ar-BB18TII5?li=BBoPWjQ
  54. Former Ghana sports minister Vanderpuye: Free Nyantakyi Movement is not wrong Goal
    http://rivington.net/en-gb/sport/football/former-ghana-sports-minister-vanderpuye-free-nyantakyi-movement-is-not-wrong/ar-BB18U7hg?li=BBoPWjQ
  55. Vettel reveals he was close to retiring from F1 before Aston Martin deal Omnisport
    http://rivington.net/en-gb/sport/news/vettel-reveals-he-was-close-to-retiring-from-f1-before-aston-martin-deal/ar-BB18Ua1g?li=BBoPWjQ
  56. Swiss rising star Hirschi lands first Tour de France victory Omnisport
    http://rivington.net/en-gb/sport/news/swiss-rising-star-hirschi-lands-first-tour-de-france-victory/ar-BB18U2vi?li=BBoPWjQ
  57. Portugal back on UK travel quarantine list as Sweden gets air bridge green light Evening Standard
    http://rivington.net/en-gb/news/newslondon/portugal-back-on-uk-travel-quarantine-list-as-sweden-gets-air-bridge-green-light/ar-BB18UbcQ?li=AAnZ9Ug
  58. Silence greets Germans braced for shrieking sirens in nationwide alarm test PA Media
    http://rivington.net/en-gb/news/uknews/silence-greets-germans-braced-for-shrieking-sirens-in-nationwide-alarm-test/ar-BB18U2mX?li=AAnZ9Ug
  59. Kate Beckinsale 'heartbroken' after her dog dies BANG Showbiz
    http://rivington.net/en-gb/entertainment/celebrity/kate-beckinsale-heartbroken-after-her-dog-dies/ar-BB18Uerm?li=AAnZ9Ug
  60. Theresa May Criticises Government Again – This Time Over Quarantine HuffPost UK
    http://rivington.net/en-gb/news/uknews/theresa-may-criticises-government-again-%e2%80%93-this-time-over-quarantine/ar-BB18U8jQ?li=AAnZ9Ug
  61. Missing man turns up at briefing on his disappearance The Washington Post
    http://rivington.net/en-gb/news/world/an-80-year-old-vanished-on-a-hike-days-later-he-showed-up-at-a-news-conference-about-his-disappearance/ar-BB18TxqW?li=AAnZ9Ug
  62. Covid news - live: England sees highest weekly increase in coronavirus cases since May as Birmingham could be next on lockdown list The Independent
    http://rivington.net/en-gb/news/uknews/covid-news-live-england-sees-highest-weekly-increase-in-coronavirus-cases-since-may-as-birmingham-could-be-next-on-lockdown-list/ar-BB18TMDz?li=AAnZ9Ug
  63. Prince Harry supports military veterans ahead of charity trek BANG Showbiz
    http://rivington.net/en-gb/entertainment/celebrity/prince-harry-supports-military-veterans-ahead-of-charity-trek/ar-BB18Ua8H?li=AAnZ9Ug
  64. Human remains found in field - police investigate 'unexplained' death Sky News
    http://rivington.net/en-gb/news/uknews/human-remains-found-in-field-police-investigate-unexplained-death/ar-BB18THqC?li=AAnZ9Ug
  65. Coronavirus: How effective are face masks at stopping spread? The Independent
    http://rivington.net/en-gb/lifestyle/style/coronavirus-how-effective-are-face-masks-at-stopping-spread/ar-BB16I09Z?li=AAnZ9Ug
  66. Scott Robertson joins Gillingham on a season-long loan Read Sport
    http://rivington.net/en-gb/sport/news/scott-robertson-joins-gillingham-on-a-season-long-loan/ar-BB18UfMy?li=AAnZ9Ug
  67. First Look at I'm A Celeb's castle Mirror
    http://rivington.net/en-gb/entertainment/tv/first-look-at-im-a-celebritys-spooky-gwrych-castle-as-restoration-gets-underway/ar-BB18TO4S?li=AAnZ9Ug
  68. Massive tarantula feasts on a whole BIRD in disturbing footage Daily Mail
    http://rivington.net/en-gb/news/world/massive-tarantula-feasts-on-a-whole-bird-in-disturbing-footage/ar-BB18U4Yw?li=AAnZ9Ug
  69. News
    http://rivington.net/en-gb/news
  70. UK NEWS
    http://rivington.net/en-gb/news/uk
  71. WORLD REPORT
    http://rivington.net/en-gb/news/worldnews
  72. BREXIT
    http://rivington.net/en-gb/news/brexit
  73. ROYALS
    http://rivington.net/en-gb/news/royal-family
  74. TECHNOLOGY
    http://rivington.net/en-gb/money/technology
  75. VIDEO
    http://rivington.net/en-gb/news/video
  76. PHOTOS
    http://rivington.net/en-gb/news/photos
  77. UK’s largest care home operator faces damages claims over Covid-19 deaths PA Media
    http://rivington.net/en-gb/news/uknews/uk-s-largest-care-home-operator-faces-damages-claims-over-covid-19-deaths/ar-BB18Uifg?li=BBoPRmx
  78. EasyJet cuts 60 pilots but avoids mass cull as it closes three bases Evening Standard
    http://rivington.net/en-gb/news/uknews/easyjet-cuts-60-pilots-but-avoids-mass-cull-as-it-closes-three-bases/ar-BB18UetT?li=BBoPRmx
  79. Phillip Schofield quizzes Jenny Harries over 'confusing' contrast in coronavirus rules Mirror
    http://rivington.net/en-gb/news/uknews/phillip-schofield-quizzes-jenny-harries-over-confusing-contrast-in-coronavirus-rules/ar-BB18TMtQ?li=BBoPRmx
  80. Amanda Kloots discusses single parent struggles after Nick Cordero's death: 'It's okay to ask for he The Independent
    http://rivington.net/en-gb/news/uknews/amanda-kloots-discusses-single-parent-struggles-after-nick-cordero-s-death-it-s-okay-to-ask-for-help/ar-BB18Ubs9?li=BBoPRmx
  81. Belgium to return tooth to family of assassinated independence leader PA Media
    http://rivington.net/en-gb/news/world/belgium-to-return-tooth-to-family-of-assassinated-independence-leader/ar-BB18Uiff?li=BBoPRmx
  82. Confusion over 'COVID marshals' who will have no power to fine or arrest Sky News
    http://rivington.net/en-gb/news/uknews/confusion-over-covid-marshals-who-will-have-no-power-to-fine-or-arrest/ar-BB18UigE?li=BBoPRmx
  83. EU tells UK: drop Brexit plans to break law or face sanctions The Guardian
    http://rivington.net/en-gb/news/uknews/eu-tells-uk-drop-brexit-plans-to-break-law-or-face-sanctions/ar-BB18TpYI?li=BBoPRmx
  84. What is Operation Moonshot and is Boris Johnson's Covid testing plan feasible? Evening Standard
    http://rivington.net/en-gb/news/newslondon/what-is-operation-moonshot-and-is-boris-johnson-s-covid-testing-plan-feasible/ar-BB18TWHc?li=BBoPRmx
  85. Entertainment
    http://rivington.net/en-gb/entertainment
  86. CELEBRITY
    http://rivington.net/en-gb/entertainment/celebrity
  87. MOVIES
    http://rivington.net/en-gb/entertainment/movies
  88. TV
    http://rivington.net/en-gb/entertainment/TV
  89. GAMES
    http://rivington.net/en-gb/entertainment/games
  90. SOAPS
    http://rivington.net/en-gb/entertainment/soaps
  91. MUSIC
    http://rivington.net/en-gb/entertainment/music
  92. BOLLYWOOD
    http://rivington.net/en-gb/entertainment/bollywood
  93. VIDEO
    http://rivington.net/en-gb/entertainment/video
  94. The Third Day – watch the new Jude Law and Naomie Harris thriller Digital Spy (UK)
    http://rivington.net/en-gb/entertainment/tv/the-third-day-watch-the-new-jude-law-and-naomie-harris-thriller/ar-BB18Ue85?li=BBoPJKU
  95. LSO/Rattle review – Turnage, Knussen and Britten make an evening to be savoured The Guardian
    http://rivington.net/en-gb/entertainment/music/lso-rattle-review-turnage-knussen-and-britten-make-an-evening-to-be-savoured/ar-BB18THnp?li=BBoPJKU
  96. The Roads Not Taken review: Sally Potter’s dementia drama is rich with intimacy, if not answers The Independent
    http://rivington.net/en-gb/entertainment/movies/the-roads-not-taken-review-sally-potter-s-dementia-drama-is-rich-with-intimacy-if-not-answers/ar-BB18TPVA?li=BBoPJKU
  97. Khloe Kardashian responds to fake KUWTK announcement Digital Spy (UK)
    http://rivington.net/en-gb/entertainment/tv/khloe-kardashian-responds-to-fake-kuwtk-announcement/ar-BB18U8G0?li=BBoPJKU
  98. These movies made us cry our eyes out Espresso
    http://rivington.net/en-gb/entertainment/movies/these-movies-made-us-cry-our-eyes-out/ss-BB18U5SG?li=BBoPJKU
  99. Doves: The Universal Want review – soaring soundtrack to changing lives The Guardian
    http://rivington.net/en-gb/entertainment/music/doves-the-universal-want-review-soaring-soundtrack-to-changing-lives/ar-BB18TRBW?li=BBoPJKU
  100. The Fresh Prince of Bel-Air 30th anniversary: Where are the cast now? The Independent
    http://rivington.net/en-gb/entertainment/tv/the-fresh-prince-of-bel-air-30th-anniversary-where-are-the-cast-now/ar-BB18Udxo?li=BBoPJKU
  101. Stars turning 70 in 2020 Wonderwall
    http://rivington.net/en-gb/entertainment/news/stars-turning-70-in-2020/ss-BB18TU6j?li=BBoPJKU
  102. Sport
    http://rivington.net/en-gb/sport
  103. FOOTBALL
    http://rivington.net/en-gb/sport/football
  104. RUGBY
    http://rivington.net/en-gb/sport/rugby-union
  105. FORMULA 1
    http://rivington.net/en-gb/sport/formula1
  106. CRICKET
    http://rivington.net/en-gb/sport/cricket
  107. TENNIS
    http://rivington.net/en-gb/sport/tennis
  108. GOLF
    http://rivington.net/en-gb/sport/golf
  109. US SPORT
    http://rivington.net/en-gb/sport/us-sport
  110. MY FAVOURITES
    http://rivington.net/en-gb/sport/my-favourites
  111. Nobody told me anything - Perez surprised by Racing Point axe and Vettel move Omnisport
    http://rivington.net/en-gb/sport/news/nobody-told-me-anything-perez-surprised-by-racing-point-axe-and-vettel-move/ar-BB18Ua1d?li=BBoPWjP
  112. Everton future transfer plans, trophy desire and every word from Carlo Ancelotti and James Rodriguez Liverpool Echo
    http://rivington.net/en-gb/sport/news/everton-future-transfer-plans-trophy-desire-and-every-word-from-carlo-ancelotti-and-james-rodriguez/ar-BB18TOmS?li=BBoPWjP
  113. Micky Mellon in Lawrence Shankland transfer quip as Dundee United boss declares striker fit to face Daily Record
    http://rivington.net/en-gb/sport/football/micky-mellon-in-lawrence-shankland-transfer-quip-as-dundee-united-boss-declares-striker-fit-to-face-rangers/ar-BB18UepM?li=BBoPWjP
  114. Premier League players to wear No Room For Racism sleeve badge throughout 2020/21 season The Independent
    http://rivington.net/en-gb/sport/football/premier-league-players-to-wear-no-room-for-racism-sleeve-badge-throughout-2020-21-season/ar-BB18UeuN?li=BBoPWjP
  115. Haas considering "close to 10" drivers for 2021 F1 seats Autosport
    http://rivington.net/en-gb/sport/formula1/haas-considering-close-to-10-drivers-for-2021-f1-seats/ar-BB18TWQ5?li=BBoPWjP
  116. Liverpool starlet 'could return to Swansea', Hull City set for Man United payout, Celtic rival Crystal Palace for £5m QPR winger - Championship Rumours Wales Online
    http://rivington.net/en-gb/sport/transfers/liverpool-starlet-could-return-to-swansea-hull-city-set-for-man-united-payout-celtic-rival-crystal-palace-for-5m-qpr-winger-championship-rumours/ar-BB18U7co?li=BBoPWjP
  117. Man City legend Vincent Kompany admits dreadful first impression of Kevin De Bruyne Mirror
    http://rivington.net/en-gb/sport/premier-league/man-city-legend-vincent-kompany-admits-dreadful-first-impression-of-kevin-de-bruyne/ar-BB18U78Z?li=BBoPWjP
  118. 'Amazing' - Aitor Karanka on Aston Villa star and Birmingham City's striker search Birmingham Mail
    http://rivington.net/en-gb/sport/transfers/amazing-aitor-karanka-on-aston-villa-star-and-birmingham-city-s-striker-search/ar-BB18U72J?li=BBoPWjP
  119. STREAMING GUIDE
    http://rivington.net/en-gb/entertainment/rf-watch-online
  120. HOTELS GUIDE
    http://rivington.net/en-gb/lifestyle/rf-best-hotels
  121. Money
    http://rivington.net/en-gb/money
  122. COMPANIES & MARKETS
    http://rivington.net/en-gb/money/markets
  123. PERSONAL FINANCE
    http://rivington.net/en-gb/money/personalfinance
  124. CAREER
    http://rivington.net/en-gb/money/career
  125. BUYING A CAR
    http://rivington.net/en-gb/cars/ownership?ocid=FROM_MSN_MONEY
  126. EXCHANGE RATES
    http://rivington.net/en-gb/money/currencyconverter
  127. MY WATCHLIST
    http://rivington.net/en-gb/money/watchlist
  128. OTHER TOOLS
    http://rivington.net/en-gb/money/tools
  129. Johnson's hard Brexit is about to deliver a devastating hit to our Covid-struck economy The Guardian
    http://rivington.net/en-gb/money/other/johnson-s-hard-brexit-is-about-to-deliver-a-devastating-hit-to-our-covid-struck-economy/ar-BB18U7x5?li=BBx1bGE
  130. Exclusive: ECB governors agreed to look through euro rise - sources
    http://rivington.net/en-gb/money/other/exclusive-ecb-governors-agreed-to-look-through-euro-rise-sources/ar-BB18Ua4R?li=AAwnS0s
  131. Hollywood's inclusion problems still run deep, study finds
    http://rivington.net/en-gb/money/other/hollywood-s-inclusion-problems-still-run-deep-study-finds/ar-BB18UemH?li=AAwnS0s
  132. Two in five Brits working from home at risk of cyber attacks
    http://rivington.net/en-gb/money/other/two-in-five-brits-working-from-home-at-risk-of-cyber-attacks/ar-BB18TO9h?li=AAwnS0s
  133. Citigroup becomes first big Wall Street bank to be run by female CEO
    http://rivington.net/en-gb/money/companies/citigroup-becomes-first-big-wall-street-bank-to-be-run-by-female-ceo/ar-BB18U8Pi?li=AAwnS0s
  134. The Savoy prepares to reopen its doors later this month
    http://rivington.net/en-gb/money/other/the-savoy-prepares-to-reopen-its-doors-later-this-month/ar-BB18Uark?li=AAwnS0s
  135. Lloyd's of London expects £5bn in Covid-19 insurance payouts
    http://rivington.net/en-gb/money/news/lloyd-s-of-london-expects-5bn-in-covid-19-insurance-payouts/ar-BB18U68X?li=AAwnS0s
  136. Pound dives as EU threatens UK over Internal Market Bill
    http://rivington.net/en-gb/money/other/pound-dives-as-eu-threatens-uk-over-internal-market-bill/ar-BB18TWhg?li=AAwnS0s
  137. Japan's Suga: Will have to call for sales tax hike in future
    http://rivington.net/en-gb/money/other/japan-s-suga-will-have-to-call-for-sales-tax-hike-in-future/ar-BB18TWd3?li=AAwnS0s
  138. Private jet flights soar back as commercial recovery lags
    http://rivington.net/en-gb/money/other/private-jet-flights-soar-back-as-commercial-recovery-lags/ar-BB18THb8?li=AAwnS0s
  139. Various Eateries circles struggling competitors
    http://rivington.net/en-gb/money/other/various-eateries-circles-struggling-competitors/ar-BB18U1xs?li=AAwnS0s
  140. Singapore Airlines to cut 4,300 jobs due to pandemic
    http://rivington.net/en-gb/money/other/singapore-airlines-to-cut-4-300-jobs-due-to-pandemic/ar-BB18U1sr?li=AAwnS0s
  141. Revealed: Ex-Goldman bankers plotted £375m Saga takeover bid
    http://rivington.net/en-gb/money/other/revealed-ex-goldman-bankers-plotted-375m-saga-takeover-bid/ar-BB18TRuj?li=AAwnS0s
  142. The jobs that take the longest to fill — and might be easier to get
    http://rivington.net/en-gb/money/careersandeducation/the-jobs-that-take-the-longest-to-fill-and-might-be-easier-to-get/ar-BB18U15s?li=AAwnS0s
  143. FTSE 100 edges into the green as Wall Street opens higher
    http://rivington.net/en-gb/money/other/ftse-100-edges-into-the-green-as-wall-street-opens-higher/ar-BB18T8pk?li=AAwnS0s
  144. ECB leaves interest rates on hold as it monitors recovery
    http://rivington.net/en-gb/money/other/ecb-leaves-interest-rates-on-hold-as-it-monitors-recovery/ar-BB18TEE7?li=AAwnS0s
  145. HALF of final salary pension transfers since Covid-19 outbreak have tell-tale signs savers are being scammed, warn fraud experts
    http://rivington.net/en-gb/money/other/half-of-final-salary-pension-transfers-since-covid-19-outbreak-have-tell-tale-signs-savers-are-being-scammed-warn-fraud-experts/ar-BB18TNGS?li=AAwnS0s
  146. Bring in airport testing by end of the month or risk 'ruin' City AM
    http://rivington.net/en-gb/money/other/bring-in-airport-testing-by-end-of-the-month-or-risk-ruin/ar-BB18TQF8?li=BBQfQii
  147. Lifestyle
    http://rivington.net/en-gb/lifestyle
  148. STYLE
    http://rivington.net/en-gb/lifestyle/style
  149. WEDDING
    http://rivington.net/en-gb/lifestyle/wedding
  150. RELATIONSHIPS
    http://rivington.net/en-gb/lifestyle/relationships
  151. GARDENING
    http://rivington.net/en-gb/lifestyle/gardening
  152. FOR GOOD
    http://rivington.net/en-gb/news/causes
  153. Why do some face masks have valves and why are they being banned? The Independent
    http://rivington.net/en-gb/lifestyle/style/why-do-some-face-masks-have-valves-and-why-are-they-being-banned/ar-BB17Hlvh?li=BBoPOOm
  154. Love Island's Kendall Rae Knight admits to suffering through painful acne battle – but cleared break OK!
    http://rivington.net/en-gb/lifestyle/style/love-island-s-kendall-rae-knight-admits-to-suffering-through-painful-acne-battle-but-cleared-breakouts-with-these-products/ar-BB18U1vs?li=BBoPOOm
  155. 8 of the best Breton tops to buy now for autumn Good Housekeeping UK
    http://rivington.net/en-gb/lifestyle/style/8-of-the-best-breton-tops-to-buy-now-for-autumn/ss-BB12Jl66?li=BBoPOOm
  156. Kerry Katona's fiancé Ryan reveals her children helped him pick ring Daily Mail
    http://rivington.net/en-gb/lifestyle/relationships/kerry-katona-s-fianc%c3%a9-ryan-reveals-her-children-helped-him-pick-ring/ar-BB18U71i?li=BBoPOOm
  157. Aldi's £80 scalloped velvet chair is back by popular demand House Beautiful (UK)
    http://rivington.net/en-gb/lifestyle/style/aldi-s-80-scalloped-velvet-chair-is-back-by-popular-demand/ar-BB10WWF9?li=BBoPOOm
  158. Tried and tested: is the Pat McGrath x Supreme lipstick worth the hype? Evening Standard
    http://rivington.net/en-gb/lifestyle/style/tried-and-tested-is-the-pat-mcgrath-x-supreme-lipstick-worth-the-hype/ar-BB18U4OI?li=BBoPOOm
  159. Reese Witherspoon celebrates lookalike daughter Ava Phillippe's 21st birthday with Instagram photos Evening Standard
    http://rivington.net/en-gb/lifestyle/style/reese-witherspoon-celebrates-lookalike-daughter-ava-phillippe-s-21st-birthday-with-instagram-photos/ar-BB18U4fU?li=BBoPOOm
  160. Vogue Williams effortlessly nails two of the biggest autumn trends Hello!
    http://rivington.net/en-gb/lifestyle/style/vogue-williams-effortlessly-nails-two-of-the-biggest-autumn-trends/ar-BB18UaRl?li=BBoPOOm
  161. Gemma Collins surprises fans in the most flattering skinny jeans Hello!
    http://rivington.net/en-gb/lifestyle/style/gemma-collins-surprises-fans-in-the-most-flattering-skinny-jeans/ar-BB18THrm?li=BBoPOOm
  162. Princess Anne has watched The Crown but mocks actress playing her for taking two hours to perfect ha The Independent
    http://rivington.net/en-gb/lifestyle/style/princess-anne-has-watched-the-crown-but-mocks-actress-playing-her-for-taking-two-hours-to-perfect-hairstyle/ar-BB17esnD?li=BBoPOOm
  163. Property
    http://rivington.net/en-gb/money/property
  164. Former golf centre to be bulldozed to make way for 800 new homes Daily Record
    http://rivington.net/en-gb/money/homeandproperty/former-golf-centre-to-be-bulldozed-to-make-way-for-800-new-homes/ar-BB18TUzZ?li=AABN2Qe
  165. Plans for 70 houses and flats former hospital site in Merthyr Wales Online
    http://rivington.net/en-gb/money/homes-property/plans-for-70-houses-and-flats-former-hospital-site-in-merthyr/ar-BB18TC6G?li=AABN2Qe
  166. Roath Park four bedroom bungalow which comes with a massive garden complete with babbling brook Wales Online
    http://rivington.net/en-gb/money/homeandproperty/roath-park-four-bedroom-bungalow-which-comes-with-a-massive-garden-complete-with-babbling-brook/ar-BB18TJaj?li=AABN2Qe
  167. Brits spend over £3,500 on hidden 'extra' costs of moving home Yahoo! Finance UK
    http://rivington.net/en-gb/money/homeandproperty/brits-spend-over-3-500-on-hidden-extra-costs-of-moving-home/ar-BB18TIIC?li=AABN2Qe
  168. Health & Fitness
    http://rivington.net/en-gb/health
  169. NUTRITION
    http://rivington.net/en-gb/health/nutrition
  170. FITNESS
    http://rivington.net/en-gb/health/fitness
  171. MIND & BODY
    http://rivington.net/en-gb/health/mindandbody
  172. Freedom of movement - how can we work together to make running more diverse? Runner's World UK
    http://rivington.net/en-gb/health/mindandbody/freedom-of-movement-how-can-we-work-together-to-make-running-more-diverse/ar-BB18U9EM?li=AAJt1k3
  173. Best treadmills: 9 top running machines for working out inside Real Homes
    http://rivington.net/en-gb/health/fitness/best-treadmills-9-top-running-machines-for-working-out-inside/ar-BB18UaOb?li=AAJt1k3
  174. Coronavirus: Oxford vaccine trial ‘to resume in days’ after side-effect checks The Independent
    http://rivington.net/en-gb/health/medical/coronavirus-oxford-vaccine-trial-to-resume-in-days-after-side-effect-checks/ar-BB18UdnU?li=AAJt1k3
  175. Coronavirus tips: Should you take paracetamol rather than ibuprofen to treat symptoms? The Independent
    http://rivington.net/en-gb/health/medical/coronavirus-tips-should-you-take-paracetamol-rather-than-ibuprofen-to-treat-symptoms/ar-BB11gUWN?li=AAJt1k3
  176. Coronavirus: What is the difference between Covid-19 and the common cold and flu? The Independent
    http://rivington.net/en-gb/health/medical/coronavirus-what-is-the-difference-between-covid-19-and-the-common-cold-and-flu/ar-BB10Z1D3?li=AAJt1k3
  177. Kayla Itsines' arms and abs workout to help improve your posture Harper's Bazaar (UK)
    http://rivington.net/en-gb/health/fitness/kayla-itsines-arms-and-abs-workout-to-help-improve-your-posture/ar-BB18U2ND?li=AAJt1k3
  178. ‘My anxiety skyrocketed’: How lockdown has impacted mental health The Independent
    http://rivington.net/en-gb/health/medical/my-anxiety-skyrocketed-how-lockdown-has-impacted-mental-health/ar-BB14w0v8?li=AAJt1k3
  179. 7 Lyme Disease Symptoms That Are Way Too Easy to Ignore Women's Health UK
    http://rivington.net/en-gb/health/medical/7-lyme-disease-symptoms-that-are-way-too-easy-to-ignore/ar-BBYMqGR?li=AAJt1k3
  180. Food & Drink
    http://rivington.net/en-gb/foodanddrink
  181. RECIPES
    http://rivington.net/en-gb/foodanddrink/recipes
  182. Zizzi unveils new pizza range which you can buy in Sainsbury’s from £4 Mirror
    http://rivington.net/en-gb/foodanddrink/other/zizzi-unveils-new-pizza-range-which-you-can-buy-in-sainsbury-s-from-4/ar-BB18U5Ui?li=AAJsMOW
  183. Our Favourite Alcoholic Advent Calendars Available To Pre-Order Now Delish UK
    http://rivington.net/en-gb/foodanddrink/other/our-favourite-alcoholic-advent-calendars-available-to-pre-order-now/ss-AAJwcwe?li=AAJsMOW
  184. There’s A Way To Get 48 Days Off Next Year Using Just 19 Days Of Your Annual Leave Delish UK
    http://rivington.net/en-gb/lifestyle/other/there-s-a-way-to-get-48-days-off-next-year-using-just-19-days-of-your-annual-leave/ar-BB18U3my?li=AAJsMOW
  185. Pumpkin Patch Brownies Are The Easiest Fall Dessert EVER Delish UK
    http://rivington.net/en-gb/foodanddrink/other/pumpkin-patch-brownies-are-the-easiest-fall-dessert-ever/vi-BB18TLxt
  186. Pumpkin Patch Brownies Use A Genius Decorating Hack Delish UK
    http://rivington.net/en-gb/foodanddrink/other/pumpkin-patch-brownies-use-a-genius-decorating-hack/ar-BB18TTxJ?li=AAJsMOW
  187. Pumpkin Pie Punch Has Everything You Want For Fall Delish UK
    http://rivington.net/en-gb/foodanddrink/other/pumpkin-pie-punch-has-everything-you-want-for-fall/vi-BB18TLxs
  188. Pumpkin Pie Punch Delish UK
    http://rivington.net/en-gb/foodanddrink/other/pumpkin-pie-punch/ar-BB18TTxK?li=AAJsMOW
  189. You Need To See How These Edible Jack-O'-Lantern Bowls Are Made Delish UK
    http://rivington.net/en-gb/video/other/you-need-to-see-how-these-edible-jack-o-lantern-bowls-are-made/vi-BB18TY3o
  190. Travel
    http://rivington.net/en-gb/lifestyle/travel
  191. NEWS
    http://rivington.net/en-gb/travel/news
  192. CURRENCY CONVERTER
    http://rivington.net/en-gb/money/currencyconverter
  193. HOTEL SEARCH
    http://rivington.net/en-gb/travel/hotels
  194. Canada's most beautiful lakes with turquoise waters, shipwrecks and even glaciers Mirror
    http://rivington.net/en-gb/travel/tripideas/canada-s-most-beautiful-lakes-with-turquoise-waters-shipwrecks-and-even-glaciers/ss-BB18U9q1?li=AAJsPCA
  195. Working virtually? Swap skyrises for ocean views, says Bermuda Reuters
    http://rivington.net/en-gb/travel/news/working-virtually-swap-skyrises-for-ocean-views-says-bermuda/ar-BB18TS1o?li=AAJsPCA
  196. Incredible tourist attractions that no longer exist Love Exploring
    http://rivington.net/en-gb/lifestyle/travel/incredible-tourist-attractions-that-no-longer-exist/ss-BB18U8NY?li=AAJsPCA
  197. Paris Hilton weighs in on Britney Spears’ conservatorship Evening Standard
    http://rivington.net/en-gb/travel/news/paris-hilton-weighs-in-on-britney-spears-conservatorship/ar-BB18TWBx?li=AAJsPCA
  198. Airlines continue to split up households and families on flights despite pandemic The Independent
    http://rivington.net/en-gb/lifestyle/travel/airlines-continue-to-split-up-households-and-families-on-flights-despite-pandemic/ar-BB18U3e0?li=AAJsPCA
  199. Coronavirus: Blackpool loses planned express connection to London The Independent
    http://rivington.net/en-gb/lifestyle/travel/coronavirus-blackpool-loses-planned-express-connection-to-london/ar-BB18U5zV?li=AAJsPCA
  200. 10 of the best paddleboarding destinations in the UK - and where to stay The Independent
    http://rivington.net/en-gb/lifestyle/travel/10-of-the-best-paddleboarding-destinations-in-the-uk-and-where-to-stay/ar-BB18U5A4?li=AAJsPCA
  201. Flight cancelled after child refuses to wear mask The Independent
    http://rivington.net/en-gb/lifestyle/travel/flight-cancelled-after-child-refuses-to-wear-mask/ar-BB18TeSO?li=AAJsPCA
  202. Cars
    http://rivington.net/en-gb/cars
  203. OWNERSHIP
    http://rivington.net/en-gb/cars/ownership
  204. REVIEWS
    http://rivington.net/en-gb/cars/reviews
  205. NEWS
    http://rivington.net/en-gb/cars/news
  206. Suzuki Jimny back in Europe as two-seater commercial vehicle motor1
    http://rivington.net/en-gb/cars/news/suzuki-jimny-back-in-europe-as-two-seater-commercial-vehicle/ar-BB18TOdj
  207. More than 1 in 3 new car buyers now choose automatic Motoring Research
    http://rivington.net/en-gb/cars/news/more-than-1-in-3-new-car-buyers-now-choose-automatic/ar-BB18TQRT
  208. Amazing barn-find Audi quattro for sale Classic & Sports Car
    http://rivington.net/en-gb/cars/enthusiasts/amazing-barn-find-audi-quattro-for-sale/ss-BB18TGGa
  209. Used Alfa Romeo Giulia review Auto Express
    http://rivington.net/en-gb/cars/news/used-alfa-romeo-giulia-review/ar-BB18TGIT
  210. Delays on the M4 after lorry spills three tons of pilau rice Daily Mail
    http://rivington.net/en-gb/cars/news/delays-on-the-m4-after-lorry-spills-three-tons-of-pilau-rice/ar-BB18TLP7
  211. 2022 Maserati Grecale SUV will be available as electric Folgore model Car Buyer
    http://rivington.net/en-gb/cars/news/2022-maserati-grecale-suv-will-be-available-as-electric-folgore-model/ar-BB18TJ9z
  212. New 'T' plates for young drivers could reduce accidents and take pressure off the roads Mirror
    http://rivington.net/en-gb/cars/news/new-t-plates-for-young-drivers-could-reduce-accidents-and-take-pressure-off-the-roads/ar-BB18Tyd5
  213. Greatest machines with 100 horsepower or less Autocar
    http://rivington.net/en-gb/cars/news/greatest-machines-with-100-horsepower-or-less/ss-BB18Sxq5
  214. Photos
    http://rivington.net/en-gb/news/photos
  215. The worst car names of all time Motoring Research
    http://rivington.net/en-gb/cars/news/the-worst-car-names-of-all-time/ss-BB18T3Ep
  216. Beautiful places you won't believe are in the UK Love Exploring
    http://rivington.net/en-gb/travel/tripideas/beautiful-places-you-won-t-believe-are-in-the-uk/ss-BB18TIqx
  217. 10 one-year wonders Classic & Sports Car
    http://rivington.net/en-gb/cars/news/10-one-year-wonders/ss-BB18Tdlo
  218. Video
    http://rivington.net/en-gb/video
  219. VIRAL
    http://rivington.net/en-gb/video/viral
  220. HEADLINES
    http://rivington.net/en-gb/video/headlines
  221. ENTERTAINMENT
    http://rivington.net/en-gb/video/entertainment
  222. TECH
    http://rivington.net/en-gb/video/tech
  223. LIFESTYLE
    http://rivington.net/en-gb/video/lifestyle
  224. SEE ALL VIDEOS
    http://rivington.net/en-gb/video/browse/mostwatchedtoday
  225. Crutches challenge... Cover Video
    http://rivington.net/en-gb/news/world/crutches-challenge/vi-BB18U6ql
  226. Kaley Cuoco claps back at mask shamers after sharing workout clip Cover Video
    http://rivington.net/en-gb/lifestyle/style/kaley-cuoco-claps-back-at-mask-shamers-after-sharing-workout-clip/vi-BB18TSdd
  227. CLARET & BLUE- We've seen strikers come in for big money in the past and not get the service, it's v Birmingham Mail
    http://rivington.net/en-gb/money/other/claret-blue-we-ve-seen-strikers-come-in-for-big-money-in-the-past-and-not-get-the-service-it-s-vital-we-play-to-watkins-strengths/vi-BB18UepO
  228. Golf carts race ends badly Cover Video
    http://rivington.net/en-gb/news/world/golf-carts-race-ends-badly/vi-BB18U6qn
  229. What schools must do if a pupil or staff member tests positive for Covid-19 Wales Online
    http://rivington.net/en-gb/money/other/what-schools-must-do-if-a-pupil-or-staff-member-tests-positive-for-covid-19/vi-BB18U7cl
  230. Hedwig, is that you? Cover Video
    http://rivington.net/en-gb/news/world/hedwig-is-that-you/vi-BB18U4Mj
  231. The Karanka answer that confirms Blues are after a striker and hints towards Jutkiewicz staying at t Birmingham Mail
    http://rivington.net/en-gb/sport/transfers/the-karanka-answer-that-confirms-blues-are-after-a-striker-and-hints-towards-jutkiewicz-staying-at-the-club/vi-BB18TOij
  232. Cats vs Donald Trump Cover Video
    http://rivington.net/en-gb/video/viral/cats-vs-donald-trump/vi-BB18TO03
  233. MSN Worldwide
    http://rivington.net/en-gb/msn-worldwide

Links - Internal (nofollow)

0:

Links - Outbound

57:
  1. Sign in
    https://login.live.com/login.srf?wa=wsignin1.0&rpsnv=13&ct=1599756805&rver=7.0.6730.0&wp=LBI&wreply=https%3a%2f%2fwww.msn.com%2fen-gb%2fhomepage%2fSecure%2fPassport%3fru%3dhttps%253a%252f%252fwww.msn.com%252fen-gb%252f%253fpfr%253d1&lc=1033&id=1184&mkt=en-gb&pcexp=True
  2. Outlook.com
    https://outlook.com/
  3. eBay Sponsored
    https://rover.ebay.com/rover/1/710-53481-19255-0/1?icep_ff3=1&pub=5575532731&toolid=10001&campid=5338626673&customid=prime-hp-mestripe-logo
  4. Office
    //afflnk.microsoft.com/c/1239701/439025/7804?sharedid=PRIME_ENGB_HP_ME&u=https://www.office.com/?omkt=en-gb%26WT.mc_id=MSN_site
  5. OneNote
    https://www.onenote.com/notebooks?WT.mc_id=MSN_OneNote_TopMenu&auth=1&wdorigin=msn
  6. Amazon Sponsored
    https://www.amazon.co.uk/?tag=engb-prime-hp-me-l1logo-21
  7. Skype
    https://www.skype.com/
  8. OneDrive
    https://onedrive.live.com/?wt.mc_id=oo_msn_msnhomepage_header
  9. Maps
    https://bing.com/maps/?FORM=MSNMAP
  10. Facebook
    https://www.facebook.com/
  11. Twitter
    https://twitter.com/
  12. What is a Microsoft account?
    https://go.microsoft.com/fwlink/?LinkID=254486
  13. SIGN IN
    https://login.live.com/login.srf?wa=wsignin1.0&rpsnv=13&ct=1599756805&rver=7.0.6730.0&wp=LBI&wreply=https%3a%2f%2fwww.msn.com%2fen-gb%2fhomepage%2fSecure%2fPassport%3fru%3dhttps%253a%252f%252fwww.msn.com%252fen-gb%252f%253fpfr%253d1&lc=1033&id=1184&mkt=en-gb&pcexp=True
  14. Create Now
    https://login.live.com/login.srf?wa=wsignin1.0&rpsnv=13&ct=1599756805&rver=7.0.6730.0&wp=LBI&wreply=https%3a%2f%2fwww.msn.com%2fen-gb%2fhomepage%2fSecure%2fPassport%3fru%3dhttps%253a%252f%252fwww.msn.com%252fen-gb%252f%253fpfr%253d1&lc=1033&id=1184&mkt=en-gb&pcexp=True
  15. Shop eBay Daily Deals
    https://rover.ebay.com/rover/1/710-53481-19255-0/1?icep_ff3=1&pub=5575532731&toolid=10001&campid=5338626673&customid=prime-hp-mestripe-titlelink
  16. Up to 60% Off Smartphones
    https://rover.ebay.com/rover/1/710-53481-19255-0/1?icep_ff3=1&pub=5575532731&toolid=10001&campid=5338626673&customid=prime-hp-mestripe-flyout1
  17. Best Tech Deals on eBay
    https://rover.ebay.com/rover/1/710-53481-19255-0/1?icep_ff3=1&pub=5575532731&toolid=10001&campid=5338626673&customid=prime-hp-mestripe-flyout2
  18. Gift Cards
    https://rover.ebay.com/rover/1/710-53481-19255-0/1?icep_ff3=1&pub=5575532731&toolid=10001&campid=5338626673&customid=prime-hp-mestripe-flyout3
  19. Save on Refurbished Home Products
    https://rover.ebay.com/rover/1/710-53481-19255-0/1?icep_ff3=1&pub=5575532731&toolid=10001&campid=5338626673&customid=prime-hp-mestripe-link1
  20. Personal Care Up to 35% Off
    https://rover.ebay.com/rover/1/710-53481-19255-0/1?icep_ff3=1&pub=5575532731&toolid=10001&campid=5338626673&customid=prime-hp-mestripe-link2
  21. Video & PC Gaming
    https://rover.ebay.com/rover/1/710-53481-19255-0/1?icep_ff3=1&pub=5575532731&toolid=10001&campid=5338626673&customid=prime-hp-mestripe-link3
  22. Amazon Marketplace
    https://www.amazon.co.uk/?tag=engb-prime-hp-me-l1logo-21
  23. Amazon Prime Enjoy fast free shipping, with a 30 day free trial of Amazon Prime
    https://www.amazon.co.uk/gp/prime/pipeline/landing?&_encoding=UTF8&tag=engb-prime-hp-me-l2link-21
  24. Today's Deals There's a new deal every day. Shop the Deal of the Day now
    https://www.amazon.co.uk/gp/deals?&_encoding=UTF8&tag=engb-prime-hp-me-l2link-21
  25. Gift Cards Give a gift instantly with an Amazon Gift Card
    https://www.amazon.co.uk/Giftcards-Giftvouchers-Vouchers-Birthday-Gifts/b/ref=nav_cs_gc?ie=UTF8&node=1571304031&_encoding=UTF8&tag=engb-prime-hp-me-l2link-21
  26. Check News Feed
    https://www.facebook.com
  27. See notifications
    https://www.facebook.com/notifications
  28. View messages
    https://www.facebook.com/messages
  29. Confirm friend requests
    https://www.facebook.com/friends/requests
  30. DATING
    https://k.ilius.net/?mtcmk=832724&fsid=103
  31. Discover the all new Echo Show from Amazon Ad Amazon
    https://www.amazon.co.uk/dp/B01KGEWACK/?tag=engb-edge-river-sponconbackfill-21
  32. Harry’s have sharpened their blades, without raising prices. Trial Set still £3.95 Ad Harry's
    https://www.harrys.com/go/gb-msn-1/?name=use%20code%20SHAVEBALM%20at%20checkout%20for%20a%20free%20Post-Shave%20Balm&utm_campaign=msn-infopane&utm_source=MSN&utm_medium=PCM
  33. Surface Studio, Surface Laptop, Surface Pro: what's the difference? Ad Microsoft
    https://afflnk.microsoft.com/c/1239701/438863/7794?sharedid=EDGE_ENGB_RIVER_BACKFILL2&u=https://www.microsoft.com/en-gb/surface/devices/help-me-choose
  34. Introducing an immersive experience with Echo Buds Ad Amazon
    https://www.amazon.co.uk/dp/B07FWGBDN6/?tag=engb-edge-river-sponconbackfill-21/?tag=engb-edge-river-sponconbackfill-21
  35. Match the letters to the numbers to crack the code
    https://puzzles.msn.com/en-gb/games/codeword?arkpromo=recommendedstripe_codeword_20200622
  36. Stop Wasting Money – This Tool Finds Every Voucher Code Online
    https://www.joinhoney.com/r/edge_UK_200901_NativeAdRotation_RobAmazonBox_9847_GhostChromeN4B-UK?utm_source=edge&utm_medium=dis&utm_campaign=edge_UK_200901_NativeAdRotation_RobAmazonBox_9847_GhostChromeN4B-UK&utm_content=GhostChromeN4B-UK&url=https%3A%2F%2Fwww.joinhoney.com%2Fg-blog%2Fthis-app-applies-every-voucher-on-the-internet-n4-uk-button
  37. DATING
    https://k.ilius.net/?mtcmk=833084&fsid=103
  38. BOOK TRAINS
    https://prf.hn/click/camref:1100l45Ad/pubref:MSN%20UK
  39. FLIGHT SEARCH
    http://flights.msn.com/en-gb/flight-search
  40. CAR HIRE
    http://carhire.msn.com/en-gb/car-hire
  41. AUTO TRADER LISTINGS
    https://www.autotrader.co.uk/?atcidp=par-car-msn&utm_medium=msn&utm_source=partnerships&utm_campaign=direct-link
  42. Introducing Echo Flex | Voice control smart home devices with Alexa Amazon
    https://www.amazon.co.uk/dp/B07PDJ9JFF?tag=engb-prime-hp-stripe-21
  43. All-new Echo Dot (3rd Gen) | Improved sound & a new design Amazon
    http://www.amazon.co.uk/dp/B0792KWK57?tag=engb-prime-hp-stripe-21
  44. Fire TV Stick 4K Ultra HD with Alexa Voice Remote | Save £10 Amazon
    https://www.amazon.co.uk/Amazon-Fire-TV-Stick-4K-Ultra-Hd-With-Alexa-Voice-Remote-Streaming-Media-Player/dp/B079QB9BD7?tag=engb-prime-hp-stripe-21
  45. Introducing Echo Show 8 | 8" HD smart display with Alexa | Save £30 Amazon
    https://www.amazon.co.uk/dp/B07SMN7FYZ?tag=engb-prime-hp-stripe-21
  46. Click here for more
    https://www.msn.com/en-gb/?item=deferred_page%3a1&ignorejs=webcore%2fmodules%2fjsbundleperfmarkerstart%3bwebcore%2fpages%2fbasepage%3bwebcore%2fpages%2fstartpage%3bwebcore%2fmodules%2flazyload%3bwebcore%2fshared%2fcore%2ftracking%2fotflogging.vnext%3bwebcore%2fmodules%2ffeedback%3bwebcore%2fmodules%2fpageheader%3bwebcore%2fmodules%2fpagefooter%3bwebcore%2fmodules%2ffloatingfeedbacklink%3bwebcore%2fmodules%2fautosuggestsnr%3bwebcore%2fmodules%2fmecontrol%3bweather%2fmodules%2ftodayminimodule%3bwebcore%2fmodules%2fheadlinesvnext%3bwebcore%2fmodules%2fexternalcontentmodule%3bwebcore%2fmodules%2fsectionheadlines%3bwebcore%2fmodules%2finfopanevnext%3bwebcore%2fmodules%2fdelayload%3bwebcore%2fmodules%2fjsbundleperfmarkerend
  47. © 2020 Microsoft
    https://www.microsoft.com/en-gb/
  48. No text
    https://itunes.apple.com/gb/app/microsoft-news/id945416273?pt=80423&ct=prime_footer&mt=8
  49. No text
    https://play.google.com/store/apps/details?id=com.microsoft.amp.apps.bingnews&hl=en-gb&referrer=utm_source=prime_footer&utm_campaign=footer
  50. Privacy & Cookies
    https://go.microsoft.com/fwlink/?LinkId=521839
  51. Terms of use
    https://go.microsoft.com/fwlink/?LinkID=246338
  52. About our Ads
    https://go.microsoft.com/fwlink/?LinkID=286759
  53. Help
    https://go.microsoft.com/fwlink/?LinkId=512703
  54. Advertise
    https://go.microsoft.com/fwlink/?linkid=875132
  55. Privacy Statement
    https://go.microsoft.com/fwlink/?LinkId=521839
  56. Help
    https://support.microsoft.com/product/msn/msn
  57. Help & Support
    https://support.microsoft.com/product/msn/msn

Links - Outbound (nofollow)

0:

Keyword Cloud for Rivington.net

amp drinkmsnhealth ampdrinkaftersportbestalexafood ampsiteusenewechonewsmakereviewcarslifestyletravelfoodnowhealth amp fitnesscoronavirusfitnesssponsoreddaysnotamp fitnessmoneyfood amp drinkhomebackentertainmentampoutliveworkinghealthmoreourlistportugalyou

Longtail Keyword Density for Rivington.net

KeywordsOccurences
health amp fitness3
food amp drink3
health amp3
amp fitness3
food amp3
amp drink3
amp9
you6
money5
coronavirus5
new5
news5
home5
travel4
sponsored4
list4
more4
use4
our4
review3
make3
not3
working3
echo3
now3
back3
days3
after3
site3
best3
out3
live3
portugal3
msn3
cars3
drink3
food3
fitness3
health3
lifestyle3
sport3
entertainment3
alexa3

Rivington.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Rivington.net is a scam?

Websites with Similar Names

Rivinascape.com
Rivinascape.com
Rivinc.com
Riv Inc. | Fine-Line Thick Film Printing Screens
Rivincita.com
Rivincita.com is for sale
Rivington.net
MSN UK: Latest news, weather, Hotmail sign in, Outlook email, Bing
Rivington151.com
rivington151.com - rivington151 Resources and Information.
Rivingtonalerts.com
rivingtonalerts.com - Registered at Namecheap.com
Rivingtonapartments.co.uk
Welcome - Site Under Maintainance
Rivingtonarms.com
澳门葡京赌场官网|澳门葡京赌场-新葡京
Rivingtonconsulting.com
Rivington Consulting

Recently Updated Websites

C8b7.com 1 second ago.Tapawaystress.com 1 second ago.Dfv.ag 2 seconds ago.Tantrayoga.us 3 seconds ago.Charactercountsmidshore.org 4 seconds ago.Terrybeigiephotography.com 4 seconds ago.Stalbansprinting.com 5 seconds ago.Swanmeadowfarm.com 7 seconds ago.Botkaput.com 7 seconds ago.Zoryanahelp.com 8 seconds ago.14square.in 9 seconds ago.Moveu2.com 9 seconds ago.Topshelfsc.com 9 seconds ago.Itpegham.com 9 seconds ago.Sinsago.co.kr 9 seconds ago.Grandcanyonengagementphotography.com 10 seconds ago.Supermac.cz 10 seconds ago.Davidmanise.com 10 seconds ago.Hadalabousa.com 11 seconds ago.Antinamotors.com 12 seconds ago.Startrepair.com 12 seconds ago.Krokvokst.com 12 seconds ago.Houndstoothandtweed.com 12 seconds ago.Rumorsofangels.org 12 seconds ago.Tulipsresort.com 12 seconds ago.Travelingmrfox.com 12 seconds ago.Thecravingsninjas.com 13 seconds ago.Wayy2cocky.com 14 seconds ago.Biendanstoncorps.com 14 seconds ago.Orrvillerailroad.com 14 seconds ago.