Road.cc  |  Cycling News | Bike Reviews | road.cc
Low trust score  | 
road.cc - the website for pedal powered people. Road cycling news, Bike reviews, Commuting, Leisure riding, Sportives and more




Road.cc Website Information

Website Ranks & Scores for Road.cc

Statvoo Rank Statvoo Rank:D
Alexa Rank Alexa Rank:37,643
Majestic Rank Majestic Rank:25,650
Domain Authority Domain Authority:52%
DMOZ DMOZ Listing:No

Whois information for road.cc

Full Whois Lookup for Road.cc Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Road.cc. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: ROAD.CC
Registry Domain ID: 86487050_DOMAIN_CC-VRSN
Registrar WHOIS Server: whois.meshdigital.com
Registrar URL: http://www.meshdigital.com
Updated Date: 2017-08-21T09:16:58Z
Creation Date: 2002-09-05T11:22:39Z
Registry Expiry Date: 2019-09-05T11:22:39Z
Registrar: MESH DIGITAL LIMITED
Registrar IANA ID: 1390
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS-116.AWSDNS-14.COM
Name Server: NS-1180.AWSDNS-19.ORG
Name Server: NS-1914.AWSDNS-47.CO.UK
Name Server: NS-944.AWSDNS-54.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-08-28T10:32:48Z

Who hosts Road.cc?

Road.cc is hosted by Webfusion Internet Solutions in England, Derby, United Kingdom, De1 3ae.
Road.cc has an IP Address of 217.199.168.61 and a hostname of ds8958.dedicated.turbodns.co.uk.



Road.cc Web Server Information

Hosted IP Address:217.199.168.61
Hosted Hostname:ds8958.dedicated.turbodns.co.uk
Service Provider:Webfusion Internet Solutions
Hosted Country:United KingdomGB
Location Latitude:52.9228
Location Longitude:-1.47663
Webserver Software:Not Applicable

HTTP Header Analysis for Road.cc

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 13 Jun 2015 13:14:04 GMT
Server: Apache
Last-Modified: Sat, 13 Jun 2015 12:55:28 GMT
ETag: "21e196a-1fee3-51865bd3552f9"
Accept-Ranges: bytes
Content-Length: 130787
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Expires: Sun, 19 Nov 1978 05:00:00 GMT
X-Powered-By: PleskLin
MS-Author-Via: DAV
Connection: close
Content-Type: text/html; charset=utf-8


Need to find out who hosts Road.cc?

Road.cc Free SEO Report

Website Inpage Analysis for Road.cc

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Road.cc

productsshoeswetshorts1 commentsyoucommentshealth ampfamilyderailleurscyclingmeter3frameslikenewstechamptrainingaeroweightamp fitnessfootageeventsmembergogoodoffersbutnearfantasyglassesleverstoolscomments morethoserightbrake amppower measurementlongourcyclist2giletsguideridingroadhealththeirbagsbikewheelsrecoveryfulldryamp recoveryshouldidpowerenergy ampsleeveguidesrearmaxpedalstubesshould youbar1brakebitqualityfantasy cyclinghelmet0 commentsridecarfitnessmiscwhichbikesgearinnerfronttimecyclistsendshydrationcarefeelsockswindhealth amp fitnessnewenergyforumglovesreviewsveryvideobestminmeasurementtyresenergy amp recoveryfasterlightsdiscountssomejerseysracksroadccpower meterfeatures0thoughuseurbanhomechain2 commentsmoremapyourshopinner tubesaftermade

Longtail Keyword Density for Road.cc

KeywordsOccurences
energy amp recovery4
health amp fitness3
amp recovery6
brake amp4
0 comments4
energy amp4
should you4
power meter4
comments more3
1 comments3
amp fitness3
inner tubes3
power measurement3
health amp3
fantasy cycling3
2 comments3
comments50
amp47
bikes25
cycling15
you13
power12
bike8
your8
jerseys8
more8
tools8
road6
brake6
06
misc6
news6
lights6
like6
recovery6
aero6
racks6
ride6
video5
health5
id5
fitness5
max5
front5
min5
good5
guide5
roadcc5
gear5
reviews4
features4
after4
cyclist4
those4
their4
meter4
which4
right4
offers4
member4
training4
sleeve4
shoes4
derailleurs4
best4
full4
gloves4
bags4
should4
rear4
pedals4
levers4
measurement4
products4
energy4
go4
but4
hydration4
13
wind3
faster3
tech3
23
wet3
some3
bit3
new3
home3
dry3
made3
cyclists3
very3
weight3
33
chain3
use3
our3
events3
inner3
socks3
tubes3
wheels3
care3
tyres3
shorts3
long3
ends3
bar3
car3
glasses3
gilets3
helmet3
family3
urban3
quality3
fantasy3
footage3
though3
riding3
feel3
shop3
map3
frames3
time3
guides3
forum3
discounts3
near3

What are the nameservers for road.cc?

Road.cc Domain Nameserver Information

HostIP AddressCountry
ns1.daily.co.uk 195.26.90.11United Kingdom United Kingdom
ns2.daily.co.uk 31.170.127.155United Kingdom United Kingdom

Road.cc Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Road.cc is a scam?