|  Cycling News | Bike Reviews |
Low trust score  | - the website for pedal powered people. Road cycling news, Bike reviews, Commuting, Leisure riding, Sportives and more Website Information

Website Ranks & Scores for

Statvoo Rank Statvoo Rank:D
Alexa Rank Alexa Rank:37,643
Majestic Rank Majestic Rank:25,650
Domain Authority Domain Authority:52%
DMOZ DMOZ Listing:No

Whois information for

Full Whois Lookup for Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: ROAD.CC
Registry Domain ID: 86487050_DOMAIN_CC-VRSN
Registrar WHOIS Server:
Registrar URL:
Updated Date: 2017-08-21T09:16:58Z
Creation Date: 2002-09-05T11:22:39Z
Registry Expiry Date: 2019-09-05T11:22:39Z
Registrar IANA ID: 1390
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientDeleteProhibited
Domain Status: clientTransferProhibited
Domain Status: clientUpdateProhibited
Name Server: NS-116.AWSDNS-14.COM
Name Server: NS-1180.AWSDNS-19.ORG
Name Server: NS-1914.AWSDNS-47.CO.UK
Name Server: NS-944.AWSDNS-54.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form:
>>> Last update of WHOIS database: 2017-08-28T10:32:48Z

Who hosts is hosted by Webfusion Internet Solutions in England, Derby, United Kingdom, De1 3ae. has an IP Address of and a hostname of Web Server Information

Hosted IP Address:
Service Provider:Webfusion Internet Solutions
Hosted Country:United KingdomGB
Location Latitude:52.9228
Location Longitude:-1.47663
Webserver Software:Not Applicable
Google Map of 50,12

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 13 Jun 2015 13:14:04 GMT
Server: Apache
Last-Modified: Sat, 13 Jun 2015 12:55:28 GMT
ETag: "21e196a-1fee3-51865bd3552f9"
Accept-Ranges: bytes
Content-Length: 130787
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Expires: Sun, 19 Nov 1978 05:00:00 GMT
X-Powered-By: PleskLin
MS-Author-Via: DAV
Connection: close
Content-Type: text/html; charset=utf-8

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

trainingnewshelmetfastermadethoseinner tubesrearmemberhealth amp fitnessgoodmapglovesgo1butrecoveryridingmorerackscyclistswhichmeterglassesfootagemischomeproductsurban0bestroadcc1 commentstimecarefeaturesfantasy cyclingmaxthoughjerseysforumbarguideenergy ampenergylikeenergy amp recoverylights3road2derailleursshopuse0 commentsaerobikesyounearchainlongbikerideverypower measurementmincaramp recoveryleverspower metertubesouraftershortsshouldshoeswindhydrationfitnessidgearinnerpedalsrighttyresbrakeofferscommentsendsnewbagsfantasycyclistweightdiscountsbitgiletsqualitycyclingbrake amphealthfamilymeasurementampfeelvideocomments moredrypowerguideseventsfrontwheelstoolsreviewstechframessomehealth ampyourtheirshould youfull2 commentsamp fitnesssockswetsleeve

Longtail Keyword Density for

energy amp recovery4
health amp fitness3
amp recovery6
brake amp4
0 comments4
energy amp4
should you4
power meter4
comments more3
1 comments3
amp fitness3
inner tubes3
power measurement3
health amp3
fantasy cycling3
2 comments3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry Kingdom United Kingdom Kingdom United Kingdom DNS Record Analysis DNS Lookup

Serial: 2015011302
Refresh: 10800
Retry: 900
Expire: 604800
road.ccMX300Priority: 10

Alexa Traffic Rank for

Alexa Search Engine Traffic for