Coupling Manufacturer - Vancouver & Quebec | Robar Industries Ltd.

Safety: Low trust score
Year Founded: 2000
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Robar Industries is a leading manufacturer of custom castings and products for the waterworks and logging industry in Canada & North America.



Domain summary

Last updated
2021-11-13
Domain label
robar
Domain extension
us
Domain registered:
2000-05-15
Domain updated:
2021-11-13
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Robar.us registered?
A: Robar.us was registered 21 years, 8 months, 1 week, 5 days, 6 hours, 30 minutes, 46 seconds ago on Monday, May 15, 2000.
Q: When was the WHOIS for Robar.us last updated?
A: The WHOIS entry was last updated 2 months, 2 weeks, 6 hours, 30 minutes, 46 seconds ago on Saturday, November 13, 2021.
Q: What are Robar.us's nameservers?
A: DNS for Robar.us is provided by the following nameservers:
  • ns2.webnames.ca
  • ns1.webnames.ca
  • ns3.webnames.ca
Q: Who is the registrar for the Robar.us domain?
A: The domain has been registered at NEUSTAR INC..
Q: What is the traffic rank for Robar.us?
A: Robar.us has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Robar.us each day?
A: Robar.us receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Robar.us resolve to?
A: Robar.us resolves to the IPv4 address .
Q: In what country are Robar.us servers located in?
A: Robar.us has servers located in the .
Q: What webserver software does Robar.us use?
A: Robar.us is powered by LiteSpeed webserver.
Q: Who hosts Robar.us?
A: Robar.us is hosted by Unknown in .
Q: How much is Robar.us worth?
A: Robar.us has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Robar.us Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Robar.us Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Robar.us

H1 Headings

1 :
  1. ROBAR – Coupling Manufacturer

H2 Headings

3 :
  1. Industries That Robar Serves
  2. Industries That Robar Serves
  3. Keeping up to date with ROBAR

H3 Headings

9 :
  1. Couplings
  2. Repair Clamps
  3. Tapping Sleeves
  4. Service Saddles
  5. Expansion Joints
  6. New Product Announcement
  7. Latest Projects
  8. Announcements
  9. PRICE INCREASE ANNOUNCEMENT

H4 Headings

4 :
  1. ROBAR Industries
  2. About Us
  3. Western Location
  4. Eastern Location

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

6 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-136337516-1

Links - Internal (nofollow)

0:

Links - Outbound

31:

Links - Outbound (nofollow)

0:

Keyword Cloud for Robar.us

couplingonlyjointsvar htmldiv documentcreateelementdivhtmldivhtmldivinnerhtml htmldivcssselectionhavecifhtmldivdocumentcreateelementdiv htmldivinnerhtml htmldivcssserviceindustriespartshascouplingsjqueryrepairhtmldiv documentgetelementbyidrspluginsettingsinlinecsshtmldiv documentcreateelementdivhtmldivcss else varyou havecanvar htmldivcsshtmldivinnerhtml htmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes0yourvarifhtmldiv htmldivinnerhtmlif yourobar industrieshtmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes0else varrepair clampsexpansionmorewesliderdocumentgetelementbyidrspluginsettingsinlinecssvar htmldiv documentgetelementbyidrspluginsettingsinlinecsspipesdocumentcreateelementdiv htmldivinnerhtmlmedia only screenifwaterclampshtmldivinnerhtml htmldivcss elseoursuchfunctionsteelusedelse var htmldivlookinghtmldivcss else0var htmldiverrormessagerevolutionhtmldivinnerhtmlwastewaterhtmldivcsstappingproductssideheaderstylingwrapperifhtmldiv htmldivinnerhtml htmldivinnerhtmlonly screenmedia onlycan be usedscreen and maxwidth800pxmediadocumentcreateelementdivhtmldivinnerhtml htmldivinnerhtml htmldivcsselsehtmldiv documentcreateelementdiv htmldivinnerhtmlcoupling manufacturerhtmldivinnerhtml htmldivinnerhtmlscreenlistfusionbuttontextincludeyoumaxwidth800pxvarietydocumentgetelementsbytagnamehead0appendchildhtmldivchildnodes0findmanufacturerrobaryoure

Longtail Keyword Density for Robar.us

KeywordsOccurences
screen and max-width800px6
media only screen4
var htmldiv documentgetelementbyidrs-plugin-settings-inline-css3
ifhtmldiv htmldivinnerhtml htmldivinnerhtml3
htmldivinnerhtml htmldivinnerhtml htmldivcss3
htmldivinnerhtml htmldivcss else3
htmldivcss else var3
else var htmldiv3
var htmldiv documentcreateelementdiv3
htmldiv documentcreateelementdiv htmldivinnerhtml3
documentcreateelementdiv htmldivinnerhtml htmldivcss3
htmldivinnerhtml htmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes03
can be used3
var htmldiv6
htmldivinnerhtml htmldivcss6
only screen6
robar industries5
media only4
htmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes03
you have3
if you3
coupling manufacturer3
documentcreateelementdiv htmldivinnerhtml3
htmldiv documentgetelementbyidrs-plugin-settings-inline-css3
htmldiv documentcreateelementdiv3
else var3
htmldivcss else3
htmldivinnerhtml htmldivinnerhtml3
ifhtmldiv htmldivinnerhtml3
var htmldivcss3
repair clamps3
robar17
var13
you10
htmldivcss9
htmldivinnerhtml9
coupling9
couplings8
industries7
only7
repair7
our7
screen6
max-width800px6
errormessage6
htmldiv6
products5
if5
steel5
can5
wastewater4
clamps4
used4
include4
media4
fusion-button-text4
function4
else4
side-header-styling-wrapper4
joints3
more3
expansion3
service3
tapping3
c3
looking3
revolution3
slider3
your3
have3
water3
find3
has3
documentgetelementbyidrs-plugin-settings-inline-css3
ifhtmldiv3
documentcreateelementdiv3
documentgetelementsbytagnamehead0appendchildhtmldivchildnodes03
03
manufacturer3
variety3
we3
parts3
list3
selection3
pipes3
youre3
such3
jquery3

Who hosts Robar.us?

Robar.us Hosting Provider Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Unknown
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:LiteSpeed

Is "Unknown" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
19.8811%
GOOGLE
13.4918%
AS-26496-GO-DADDY-COM-LLC
3.5494%
NAMECHEAP-NET
3.0231%
AMAZON-AES
2.1497%
GoDaddy.com, LLC
2.0016%
UNIFIEDLAYER-AS-1
1.8740%
Fara Negar Pardaz Khuzestan
1.5314%
CONFLUENCE-NETWORK-INC
1.4027%
1&1 Internet AG
1.2887%

HTTP Header Analysis for Robar.us

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Connection: Keep-Alive
Keep-Alive: timeout=5, max=100
x-powered-by: PHP/7.2.34
content-type: text/html; charset=UTF-8
link:; rel=shortlink
etag: "4-1636708912;gz"
x-litespeed-cache: hit
transfer-encoding: chunked
content-encoding: gzip
vary: Accept-Encoding
date: Sat, 13 Nov 2021 08:05:47 GMT
server: LiteSpeed
alt-svc: h3=":443"; ma=2592000, h3-29=":443"; ma=2592000, h3-Q050=":443"; ma=2592000, h3-Q046=":443"; ma=2592000, h3-Q043=":443"; ma=2592000, quic=":443"; ma=2592000; v="43,46"

Robar.us Domain Nameserver Information

HostIP AddressCountry
ns2.webnames.ca 3.33.157.98
ns1.webnames.ca 15.197.158.164
ns3.webnames.ca 52.223.45.146


Need to find out who hosts Robar.us?


Domain Registration (WhoIs) information for Robar.us

 Domain Name: robar.us
Registry Domain ID: D36172741-US
Registrar WHOIS Server: whois.webnames.ca
Registrar URL: webnames.ca
Updated Date: 2021-09-21T15:03:41Z
Creation Date: 2012-05-15T21:44:46Z
Registry Expiry Date: 2022-05-14T23:59:59Z
Registrar: Webnames.ca Inc.
Registrar IANA ID: 456
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8662217878
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: C36173176-US
Registrant Name: Jackie Levy
Registrant Organization: Robar Industries Ltd
Registrant Street: 12945 78th Avenue
Registrant Street:
Registrant Street:
Registrant City: Surrey
Registrant State/Province: BC
Registrant Postal Code: V3W 2X8
Registrant Country: CA
Registrant Phone: +1.6045922735
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Application Purpose: P1
Registrant Nexus Category: C21
Registry Admin ID: C36173177-US
Admin Name: Jackie Levy
Admin Organization: Robar Industries Ltd
Admin Street: 12945 78th Avenue
Admin Street:
Admin Street:
Admin City: Surrey
Admin State/Province: BC
Admin Postal Code: V3W 2X8
Admin Country: CA
Admin Phone: +1.6045922735
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Application Purpose: P1
Admin Nexus Category: C21
Registry Tech ID: C36173178-US
Tech Name: Jackie Levy
Tech Organization: Robar Industries Ltd
Tech Street: 12945 78th Avenue
Tech Street:
Tech Street:
Tech City: Surrey
Tech State/Province: BC
Tech Postal Code: V3W 2X8
Tech Country: CA
Tech Phone: +1.6045922735
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Login to show email
Application Purpose: P1
Tech Nexus Category: C21
Name Server: ns1.webnames.ca
Name Server: ns2.webnames.ca
Name Server: ns3.webnames.ca
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2021-11-13T08:05:48Z

Websites with Similar Names

Robar.com
Home - Robar Enterprises, Inc.
Robar.es
robar.es -&nbspThis website is for sale! -&nbsprobar Resources and Information.
Robar.us
Coupling Manufacturer - Vancouver & Quebec | Robar Industries Ltd.
Robar195372.shop
robar195372.shop
Robaraindustries.com
Robara industries de technische groothandel van Nederland
Robarbolinofullysickcunt.com
Home - robarbolinofullysickcunt.com

Recently Updated Websites

Mobile60.xyz (1 second ago.)Safrican.africa (6 seconds ago.)Presale.shop (8 seconds ago.)Advimmo.fr (8 seconds ago.)Apolloroofing.net (12 seconds ago.)Livemusiconlinenow.com (12 seconds ago.)Christianbreil.com (21 seconds ago.)Copyblog.org (22 seconds ago.)Nnpress.com (23 seconds ago.)Betternutri.com (24 seconds ago.)Bigcitymusic.com (24 seconds ago.)Xrbiometrics.com (26 seconds ago.)Nadikosenkova.com (26 seconds ago.)Cardosoepaula.com (27 seconds ago.)Designcontainers.net (27 seconds ago.)T-kabu.com (27 seconds ago.)Hansmithconstruction.com (28 seconds ago.)Fullstackcannabis.com (29 seconds ago.)Westfieldindurance.com (29 seconds ago.)Paytm.cam (30 seconds ago.)Silvermoonassistedliving.com (32 seconds ago.)Immiconnect.com (32 seconds ago.)Expressofts.com (32 seconds ago.)Whoyouareinchrist.info (33 seconds ago.)Rudow.com (33 seconds ago.)Downtownrider.com (34 seconds ago.)Rac.careers (34 seconds ago.)Casc-llc.net (34 seconds ago.)Sharon-kenny.com (34 seconds ago.)Gettyimages.it (34 seconds ago.)

Recently Searched Keywords

et auction (1 second ago.)managing director (2 seconds ago.)automotive electronics design fundamentals (2 seconds ago.)nos cts (3 seconds ago.)logements atypiques (4 seconds ago.)bloomberg (@business) (5 seconds ago.)hostages we just (5 seconds ago.)our progress (6 seconds ago.)asiatique (6 seconds ago.)jouez (6 seconds ago.)9 tasty ways to preserve your eggplant harvest (9 seconds ago.)مناقصات شهرداری منطقه 7 اهواز (11 seconds ago.)20 oct. 2016 — ann16075 the future of alpha centauri (11 seconds ago.)mackay regional council (13 seconds ago.)sponsorship in uae (15 seconds ago.)ease 0s--shdnone--bgvar--color19--brdvar--color12--brw0px--fntnormal (15 seconds ago.)поделки (15 seconds ago.)मुखपृष्ठ (16 seconds ago.)agriscience (17 seconds ago.)surmonter vos (17 seconds ago.)musikkvideo (18 seconds ago.)JD Rowe Financial (18 seconds ago.)guardar sus (19 seconds ago.)topachat (19 seconds ago.)group of 3 (20 seconds ago.)0 2px 999 (22 seconds ago.)2550 aed to inr (23 seconds ago.)dmg mori deutschland kundennähe in ihrer region – wir sind für sie da. (23 seconds ago.)8211 tbd (24 seconds ago.)yoani sánchez (26 seconds ago.)