Mail Order Bride - Hot Real Brides for Marriage at rosebrides.org

Safety: Low trust score
Year Founded: 2018
Global Traffic Rank: 20,127
Estimated Worth: $1,893,240
Category: This site has not been categorized yet

Mail order brides services work all around the globe, introducing single gentlemen to eligible ladies from a variety of countries. Essentially…



Domain summary

Last updated
2020-11-04
Domain label
rosebrides
Domain extension
org
Domain registered:
2018-09-18
Domain updated:
2020-11-04
Global Traffic Rank
20,127
Statvoo Rating
C
Trust Score
Low Trust Score
Estimated worth
$1,893,240
Estimated daily income
$1,753
Estimated monthly income
$53,320

Frequently Asked Questions (FAQ)

Q: When was Rosebrides.org registered?
A: Rosebrides.org was registered 2 years, 11 months, 4 weeks, 1 day, 16 hours, 56 minutes, 5 seconds ago on Tuesday, September 18, 2018.
Q: When was the WHOIS for Rosebrides.org last updated?
A: The WHOIS entry was last updated 10 months, 1 week, 6 days, 16 hours, 56 minutes, 5 seconds ago on Wednesday, November 4, 2020.
Q: What are Rosebrides.org's nameservers?
A: DNS for Rosebrides.org is provided by the following nameservers:
  • doug.ns.cloudflare.com
  • sima.ns.cloudflare.com
Q: Who is the registrar for the Rosebrides.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Rosebrides.org?
A: Rosebrides.org ranks 20,127 globally on Alexa. Rosebrides.org has a Low Trust Score, and a Statvoo Rank of C.
Q: How many people visit Rosebrides.org each day?
A: Rosebrides.org receives approximately 219,124 visitors and 1,752,992 page impressions per day.
Q: What IP address does Rosebrides.org resolve to?
A: Rosebrides.org resolves to the IPv4 address 172.67.217.81.
Q: In what country are Rosebrides.org servers located in?
A: Rosebrides.org has servers located in the United States.
Q: What webserver software does Rosebrides.org use?
A: Rosebrides.org is powered by CloudFlare webserver.
Q: Who hosts Rosebrides.org?
A: Rosebrides.org is hosted by T-Mobile USA, Inc. in United States.
Q: How much is Rosebrides.org worth?
A: Rosebrides.org has an estimated worth of $1,893,240. An average daily income of approximately $1,753, which is roughly $53,320 per month.

Rosebrides.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Rosebrides.org Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Rosebrides.org

H1 Headings

2 :
  1. Pick the right mail order brides website
  2. Pick the right mail order brides website

H2 Headings

5 :
  1. Mail order brides: some general insight
  2. Mail order brides: some general insight
  3. Mail order brides by region
  4. Things to consider before joining
  5. Final word on international dating

H3 Headings

7 :
  1. Asian brides & their Orient charm
  2. Slavic brides & their incredible wit
  3. Latino brides & their seductive looks
  4. Website niche, focus, and demographics
  5. Subscription plan that suits you best
  6. Interactive features and functionality
  7. Legal and travel support, if any

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

2 :

Total Images

13 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

47:

Links - Internal (nofollow)

0:

Links - Outbound

2:

Links - Outbound (nofollow)

0:

Keyword Cloud for Rosebrides.org

splittestrvwimgcookiesplittestrvwvidmail order brideprivacy policysupportnull if typeofsuccessusingchoosepeopleparamssplittestarrayrvwimghaveyourresponsivesome generalno matterreasonmotherstheseinternational dating sitessureyou should notyou cantooherprivacycountriesbrides servicesourslavic bridesapproachsuccess function datajsonconstcookiesplittestquizusersothershouldeverythingvisititsworldsiteasian womenhusbandssessionpagekeymanyonlineyou shouldjquerydocumentreadyfunctioncouldanyinternational datingservicesplentytopif yourealperksasian brideschoicescreenbesteach3cookiesplittestrvwimgparamssplittestarrayquizinsightpersonmoderateurldating servicesprimarymatterareasdatatypeyoullcomeslengthslidestoscrollbeautifulorder brideintovisit sitemail order bridesassumptionsplittestquizso youkindhighukrainianlikemost datinggetwantjustdatawould notladies havebeautycommunicationbeforewelldecisionmakefixedlinkkeydatatype jsonsome general insightnoneslidestoscroll 1 variablewidthyou maynotslavicmembersmonthlychargemaydontfeeipwouldcountiesyourskeyoffersinglesessionpagevalvariablewidth falseprofessional mail orderdescribecandifferentussuccess functionsubscribernametypeofnowfunction datajsonnoinfinitealwayssettingsmeansmake suregeneralnull ifbutslidestoscroll 1settings slidestoshowgofirstthese beautifulwifenewisgreyblockparamssplittestletthem2chattingperfecteuropeyetmenasianregexpsuchdating sitesjquerydocumentreadyfunction lethoweveruseplatformpostuserlatintruereallyjsonladiesyoureseecertainmatter iftype postajaxparamssplittestarrayrvwvidoverpaythoseclientsgood match1 variablewidth falsebrideknowescapeuser experiencesitesexperienceoutmatchcontactsoenvironmentscoursewebsitespolicyif typeofmailvarietyhave nonew regexpgoodtype post urlexistvar1 variablewidtheducationsome ladiespartnerread reviewtheyfind a goodshould notmarriageno matter ifbothstartwomenbesideslookingmoresomeeverythanfindgeneral insighttimepathheightdescriptionelemcontextsearchprofessional mailelse ifemailsreview visit sitemay notlatinosecurityfeaturessplittestrvwviddreamdowhichslidestoshowbrides theirunlimitedthinkplatformsfalseundefinedevenparamssplittestserverreviewimageorder brides servicesajax type posttypeensuringtherebecauseletwomanvideoordereuropeannull paramssplittestserverreviewimagestillparticularlinkvalueservicedatajsonelse if typeofurlparamculturalwomen who joinsome platformsbridesyousplittestparametrsread review visitrussianvariablewidthbreakpointprofessional0mail orderreview visitallmeetjoinmostwayifexpiresconsiderread morewholerightloveonenullmythsbetterlatino womenorder bridessimplypost urlfunctionalsoyou may wantwebsiteloyalsubscriptiongroomsworthpersonallifelocalsinglesreadtheirreasonsreturnexcellentmuchratherajax typewereviewdatingemailadditionalmay wantcountryinternationalelse1

Longtail Keyword Density for Rosebrides.org

KeywordsOccurences
mail order brides18
order brides services9
review visit site5
read review visit5
women who join4
mail order bride3
null if typeof3
success function datajson3
type post url3
ajax type post3
you should not3
you may want3
find a good3
professional mail order3
no matter if3
international dating sites3
some general insight3
1 variablewidth false3
slidestoscroll 1 variablewidth3
else if typeof3
mail order23
order brides18
read more12
brides services9
if typeof9
you can7
you should6
international dating6
dating sites6
if you6
slidestoscroll 16
you may5
else if5
visit site5
review visit5
read review5
settings slidestoshow4
new regexp4
good match4
ladies have4
so you4
should not3
slavic brides3
may not3
latino women3
asian brides3
some platforms3
ajax type3
type post3
post url3
datatype json3
asian women3
function datajson3
privacy policy3
null if3
success function3
professional mail3
brides their3
have no3
1 variablewidth3
variablewidth false3
some general3
general insight3
these beautiful3
would not3
some ladies3
dating services3
order bride3
most dating3
no matter3
matter if3
may want3
make sure3
user experience3
jquerydocumentreadyfunction let3
null paramssplittestserverreviewimage3
you58
if52
brides46
they33
not31
all24
their24
have24
order24
women23
so23
mail23
some22
dating21
read20
any19
ladies19
let18
more18
can17
find17
services16
most16
your15
but14
014
function14
platforms13
sites12
asian12
site12
looking12
urlparam12
would12
jquerydocumentreadyfunction12
these12
may12
null12
however11
still11
them11
use11
else11
best11
bride10
no10
true10
match9
well9
local9
marriage9
false9
men9
typeof9
undefined9
even8
make8
18
person8
one8
we8
good8
time7
splittestquiz7
than7
splittestrvwimg7
join7
want7
slavic7
its7
splittestrvwvid7
different7
linkvalue7
youre7
also7
do7
other7
isgreyblock7
websites7
woman7
world7
should7
new7
slidestoscroll6
online6
members6
international6
which6
slidestoshow6
our6
those6
paramssplittestserverreviewimage6
just6
offer6
plenty6
get6
know6
first6
url5
sessionpagekey5
sure5
besides5
paramssplittestarrayrvwvid5
professional5
security5
support5
before5
paramssplittestarrayquiz5
there5
paramssplittestarrayrvwimg5
exist5
communication5
additional5
sessionpageval5
datajson5
features5
latino5
pay5
linkkey5
too5
review5
general5
single5
visit5
none5
25
variablewidth4
beauty4
grooms4
consider4
fee4
service4
email4
partner4
length4
course4
clients4
youll4
data4
many4
better4
responsive4
success4
love4
worth4
because4
meet4
education4
settings4
breakpoint4
return4
emails4
dream4
means4
people4
charge4
really4
top4
choose4
ensuring4
such4
website4
cultural4
matter4
elemcontextsearch4
beautiful4
whole4
simply4
primary4
comes4
yet4
right4
insight4
using4
regexp4
parametrs4
path4
reasons4
users4
screen4
cookiesplittestrvwvid3
latin3
ukrainian3
unlimited3
split-test3
video3
paramssplittestlet3
cookiesplittestrvwimg3
key3
subscription3
fixed3
every3
russian3
ajax3
decision3
heightdescription3
ip3
subscribername3
const3
expires3
var3
policy3
privacy3
json3
way3
datatype3
dont3
chatting3
over3
post3
type3
cookiesplittestquiz3
european3
singles3
rather3
could3
describe3
contact3
both3
experience3
user3
start3
high3
into3
each3
platform3
myths3
like3
moderate3
perks3
environments3
assumption3
real3
now3
personal3
approach3
yours3
counties3
reason3
escape3
kind3
monthly3
choice3
us3
infinite3
country3
much3
mothers3
particular3
europe3
excellent3
think3
husbands3
certain3
everything3
life3
her3
always3
out3
perfect3
see3
areas3
go3
wife3
variety3
countries3
loyal3
33

Who hosts Rosebrides.org?

Rosebrides.org Hosting Provider Information

Hosted IP Address:172.67.217.81
Hosted Hostname:172.67.217.81
Service Provider:T-Mobile USA, Inc.
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "T-Mobile USA, Inc." in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.4810%
Unknown
8.7814%
AS-26496-GO-DADDY-COM-LLC
4.6042%
NAMECHEAP-NET
3.7023%
AMAZON-AES
2.7678%
GoDaddy.com, LLC
2.4095%
UNIFIEDLAYER-AS-1
2.4018%
Fara Negar Pardaz Khuzestan
2.0303%
CONFLUENCE-NETWORK-INC
1.7535%
1&1 Internet AG
1.6915%
T-Mobile USA, Inc.
1.4318%

HTTP Header Analysis for Rosebrides.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 04 Nov 2020 10:36:44 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding,Cookie
Cache-Control: max-age=3, must-revalidate
CF-Cache-Status: DYNAMIC
cf-request-id: 06346da50f0000dc27b1886000000001
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Report-To: {"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report?s=gogStT2bHCPoQ6CG7xxE8GrwMf00Nq802+cEqdZsYgmLQo9TOU2s0QYoJ1ZdxTaooLFeYG6F+e5XNJvEE+exd5pyK00ytvSblzYQPwPliw=="}],"group":"cf-nel","max_age":604800}
NEL: {"report_to":"cf-nel","max_age":604800}
Server: cloudflare
CF-RAY: 5ecdb21b4c4bdc27-LHR
Content-Encoding: gzip

Rosebrides.org Domain Nameserver Information

HostIP AddressCountry
doug.ns.cloudflare.com 108.162.193.159
sima.ns.cloudflare.com 108.162.192.222


Need to find out who hosts Rosebrides.org?


Domain Registration (WhoIs) information for Rosebrides.org

 Domain Name: ROSEBRIDES.ORG
Registry Domain ID: D402200000007672377-LROR
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 2019-08-19T12:38:59Z
Creation Date: 2018-09-18T10:04:22Z
Registry Expiry Date: 2020-09-18T10:04:22Z
Registrar Registration Expiration Date:
Registrar: NameCheap, Inc.
Registrar IANA ID: 1068
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.6613102107
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization:
Registrant State/Province: Panama
Registrant Country: PA
Name Server: DOUG.NS.CLOUDFLARE.COM
Name Server: SIMA.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-09-09T00:29:31Z

Websites with Similar Names

Roseb.rocks
Felix Rosebrock - Welcome
Roseb76q2.xyz
Welcome to roseb76q2.xyz
Roseb76q3.xyz
Welcome to roseb76q3.xyz
Roseb78q0.xyz
Welcome to roseb78q0.xyz
Rosebabes.com
Domain Sales Page | Flippa.com
Rosebaby.org
Rosebaby.org
Rosebackenscykelomotor.se
Rösebäckens Cykel & Motor - rösebäcken, moped, mofa, mokick, knallert, moppe, oldtimers, elfström, shopper, partner, dolmar, monark, crescent, sachs, gilera, hmn, cacal, dbs, williers, nsu, solex, attala, jawa, fram, victoria, dkw, rex, puch, huskvarna, nv, kreidler, mcb, anker, morini, drac, tanaka, mustang, yamaha, suzuki, zündapp, express, tomos, ico, pilot, komar

Recently Updated Websites

Skupadlite.com (2 seconds ago.)Mevipu.com (3 seconds ago.)Yayu663.app (4 seconds ago.)Link2career.com (5 seconds ago.)Leads-profit.com (6 seconds ago.)Warp.group (6 seconds ago.)Reincarnationofbeethoven.com (8 seconds ago.)Risecp.com (10 seconds ago.)Ritabunny.com (11 seconds ago.)Sevenstudio.info (12 seconds ago.)Boxify.com (14 seconds ago.)Alaintruong.com (15 seconds ago.)Realibericademonteros.com (16 seconds ago.)Andrewbear.photo (17 seconds ago.)Chancerylanelegal.net (17 seconds ago.)Corsofacile.info (17 seconds ago.)Havanaharvestfestival.com (19 seconds ago.)Fromtheheartmarket.com (19 seconds ago.)Citizensofhumanity.com (21 seconds ago.)Deadseriousrecords.com (22 seconds ago.)Sailingwithstardust.com (23 seconds ago.)Tokyobuilt.com (23 seconds ago.)Blockchaintechnologyadvisers.com (24 seconds ago.)Erent.com.tw (24 seconds ago.)233wz.cn (25 seconds ago.)Transasiantravel.com (25 seconds ago.)Samvminf.uz (25 seconds ago.)Structuredfocus.com (25 seconds ago.)Omero.xyz (26 seconds ago.)Chikmagalurtourism.com (26 seconds ago.)

Recently Searched Keywords

vincent-st (1 second ago.)top mystickywelcomebarheight px (1 second ago.)gamat (2 seconds ago.)goats (3 seconds ago.)slots village 100 (3 seconds ago.)trendroad.com 4799 (4 seconds ago.)hand-delivered (4 seconds ago.)style-jyfp1x03item border-radius0 (6 seconds ago.)docandmark (7 seconds ago.)马蜂窝+瑞士 (7 seconds ago.)lei cumpara -45 (7 seconds ago.)推荐27 (7 seconds ago.)ta2020-10-20 (8 seconds ago.)sohbet ve (9 seconds ago.)ndirim (11 seconds ago.)lereturnlfunctiontypeof (11 seconds ago.)ligula sit amet (14 seconds ago.)статьи и публикации (15 seconds ago.)beauty personalmaking beauty (16 seconds ago.)corporate data (17 seconds ago.)rc2 mmc micro mooch case (17 seconds ago.)district initiatives (17 seconds ago.)gilbertine kitchen (18 seconds ago.)breitling endurance pro (18 seconds ago.)randb (19 seconds ago.)amit saini rohtakiya (20 seconds ago.)product inserts (20 seconds ago.)dcfix 1 (21 seconds ago.)drsquoautonomie (21 seconds ago.)تخم مرغ پز (22 seconds ago.)