Royalsocietypublishing.org  |  Home | Royal Society Publishing
Low trust score  | 



Royalsocietypublishing.org Website Information

Website Ranks & Scores for Royalsocietypublishing.org

Statvoo Rank Statvoo Rank:C
Alexa Rank Alexa Rank:25,534
Majestic Rank Majestic Rank:2,203
Domain Authority Domain Authority:75%
DMOZ DMOZ Listing:No

Whois information for royalsocietypublishing.org

Full Whois Lookup for Royalsocietypublishing.org Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Royalsocietypublishing.org. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: ROYALSOCIETYPUBLISHING.ORG
Registry Domain ID: D152778610-LROR
Registrar WHOIS Server:
Registrar URL: http://www.tucows.com
Updated Date: 2017-04-22T04:00:35Z
Creation Date: 2008-05-21T17:18:19Z
Registry Expiry Date: 2018-05-21T17:18:19Z
Registrar Registration Expiration Date:
Registrar: Tucows Inc.
Registrar IANA ID: 69
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Reseller:
Domain Status: ok https://icann.org/epp#ok
Registry Registrant ID: C121624169-LROR
Registrant Name: Mark Houts
Registrant Organization: HighWire Press
Registrant Street: Stanford University
Registrant Street: 1454 Page Mill Rd.
Registrant City: Palo Alto
Registrant State/Province: Ca
Registrant Postal Code: 94304
Registrant Country: US
Registrant Phone: +1.6507255937
Registrant Phone Ext:
Registrant Fax: +1.6507259335
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C121624168-LROR
Admin Name: Mark Houts
Admin Organization: HighWire Press
Admin Street: Stanford University
Admin Street: 1454 Page Mill Rd.
Admin City: Palo Alto
Admin State/Province: Ca
Admin Postal Code: 94304
Admin Country: US
Admin Phone: +1.6507255937
Admin Phone Ext:
Admin Fax: +1.6507259335
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C121624171-LROR
Tech Name: Mark Houts
Tech Organization: HighWire Press
Tech Street: Stanford University
Tech Street: 1454 Page Mill Rd.
Tech City: Palo Alto
Tech State/Province: Ca
Tech Postal Code: 94304
Tech Country: US
Tech Phone: +1.6507255937
Tech Phone Ext:
Tech Fax: +1.6507259335
Tech Fax Ext:
Tech Email: Login to show email
Server: CARL.NS.CLOUDFLARE.COM
Name Server: YOLANDA.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-08-28T16:16:21Z

Who hosts Royalsocietypublishing.org?

Royalsocietypublishing.org is hosted by Stanford University in California, Stanford, United States, 94305.
Royalsocietypublishing.org has an IP Address of 171.67.115.68 and a hostname of apt.rcpsych.org.



Royalsocietypublishing.org Web Server Information

Hosted IP Address:171.67.115.68
Hosted Hostname:apt.rcpsych.org
Service Provider:Stanford University
Hosted Country:United StatesUS
Location Latitude:37.4213
Location Longitude:-122.164
Webserver Software:Not Applicable
Google Map of 50,12

Websites Hosted on Same IP (i.e. 171.67.115.68)

Blood Journal | Home
- bloodjournal.org

  42,592   $ 265,680.00

Home | Haematologica
- haematologica.org

  349,037   $ 19,980.00

bioRxiv.org - the preprint server for Biology
- biorxiv.org

bioRxiv - the preprint server for biology, operated by Cold Spring Harbor Laboratory, a research and educational institution

  53,785   $ 210,240.00

Bone & Joint
- boneandjoint.org.uk

  186,965   $ 49,800.00

Home | British Journal of General Practice
- bjgp.org

  825,991   $ 1,200.00

HTTP Header Analysis for Royalsocietypublishing.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 18 Jun 2015 17:13:55 GMT
Server: Apache/2.2.3 (CentOS)
Expires: Sun, 19 Nov 1978 05:00:00 GMT
Last-Modified: Thu, 18 Jun 2015 17:13:55 GMT
Cache-Control: no-cache, must-revalidate, post-check=0, pre-check=0
ETag: "1434647635"
X-Highwire-Cache: no-cache
Content-Language: en
X-Generator: Drupal 7 (http://drupal.org)
Vary: Accept-Encoding
Content-Encoding: gzip
X-Highwire-Sitecode: roysoc
Content-Length: 7253
Connection: close
Content-Type: text/html; charset=utf-8


Need to find out who hosts Royalsocietypublishing.org?

Royalsocietypublishing.org Free SEO Report

Website Inpage Analysis for Royalsocietypublishing.org

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Royalsocietypublishing.org

biologicaljavascriptdirectoryjournalaugustthemed issuespolicieslifestatus opensciences editorinchief professorresearch and reviewsfrs accesssubjectmathematicalresearch0proceedingsauthors librariansprofessoropenfundingstatuslife sciencescompetitionsciences editorinchiefcentury scienceopen accesssystemspublishingfellows directorysciences researchauthorsphysical scienceseventseditorinchieftransactionsmemoirshistoryviewjournal publishingcomputationalfastbaccess status openphysicsopen scienceroyal societyphilosophical transactionsawardsethicsaccess options availablesciences themedcomputerallissuesenvironmentalcenturyourlife sciences editorinchiefmechanicshealthcontentopen access optionsscientificavailablemoleculargovernancesignengineeringlibrarianssign upconnectquantumfrschemistryacrosstheoryshowyearsaccess statushighupdatesaccessphysicaloptionsmathematicsbiophysicsbenefitsscienceinterfacechemicalrssclimatebiologyphilosophicalsearchcrossdisciplinarythemedreviewsalertsbiographicalsocietyauthorgrantsrss feedsnewenergysciences themed issuestechnologymedicalinternationalbiological sciencesyourfeedscomputingroyalstatus open accesshistory of sciencefrs access statusaccess optionsjournalsemail alertsemailcellularsciencesoptions availablefellowsupeditorinchief professorusmore

Longtail Keyword Density for Royalsocietypublishing.org

KeywordsOccurences
frs access status9
status open access8
access options available8
open access options8
access status open8
sciences editor-in-chief professor6
research and reviews4
history of science3
sciences themed issues3
life sciences editor-in-chief3
open access14
access status10
editor-in-chief professor10
royal society9
frs access9
status open8
access options8
options available8
sciences editor-in-chief6
century science6
sign up5
sciences research4
philosophical transactions4
open science4
fellows directory4
themed issues4
journal publishing4
life sciences4
email alerts3
rss feeds3
sciences themed3
authors librarians3
biological sciences3
physical sciences3
access27
science26
open21
history19
research18
physics17
sciences16
biology16
theory14
engineering14
chemistry14
publishing13
editor-in-chief11
status10
professor10
all10
fellows10
frs9
society9
journal9
royal9
available8
journals8
search8
options8
our7
physical7
scientific7
connect6
content6
themed6
interface6
issues6
century6
reviews5
us5
computational5
05
authors5
across5
molecular5
up5
sign5
mathematical5
computing5
more5
cross-disciplinary5
memoirs4
email4
rss4
computer4
chemical4
cellular4
biophysics4
proceedings4
b4
governance4
new4
awards4
events4
funding4
ethics4
directory4
energy4
climate4
high4
grants4
mathematics4
philosophical4
fast4
transactions4
life4
systems3
health3
medical3
quantum3
environmental3
alerts3
feeds3
august3
updates3
biological3
technology3
javascript3
subject3
biographical3
your3
benefits3
view3
international3
years3
librarians3
mechanics3
policies3
competition3
show3
author3

What are the nameservers for royalsocietypublishing.org?

Royalsocietypublishing.org Domain Nameserver Information

HostIP AddressCountry
ns3.p20.dynect.net 208.78.71.20United States United States
ns1.p20.dynect.net 208.78.70.20United States United States
ns2.p20.dynect.net 204.13.250.20United States United States
ns4.p20.dynect.net 204.13.251.20United States United States

Royalsocietypublishing.org DNS Record Analysis DNS Lookup

HostTypeTTLExtra
royalsocietypublishing.orgA10785IP: 171.67.115.68
royalsocietypublishing.orgNS172800Target: ns2.p20.dynect.net
royalsocietypublishing.orgNS172800Target: ns1.p20.dynect.net
royalsocietypublishing.orgNS172800Target: ns3.p20.dynect.net
royalsocietypublishing.orgNS172800Target: ns4.p20.dynect.net
royalsocietypublishing.orgSOA172800MNAME: ns1.p20.dynect.net
RNAME: namedb.highwire.stanford.edu
Serial: 2015052001
Refresh: 10800
Retry: 600
Expire: 604800

Alexa Traffic Rank for Royalsocietypublishing.org


Alexa Search Engine Traffic for Royalsocietypublishing.org