|  Home | Royal Society Publishing
Low trust score  | Website Information

Website Ranks & Scores for

Statvoo Rank Statvoo Rank:C
Alexa Rank Alexa Rank:25,534
Majestic Rank Majestic Rank:2,203
Domain Authority Domain Authority:75%
DMOZ DMOZ Listing:No

Whois information for

Full Whois Lookup for Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Registry Domain ID: D152778610-LROR
Registrar WHOIS Server:
Registrar URL:
Updated Date: 2017-04-22T04:00:35Z
Creation Date: 2008-05-21T17:18:19Z
Registry Expiry Date: 2018-05-21T17:18:19Z
Registrar Registration Expiration Date:
Registrar: Tucows Inc.
Registrar IANA ID: 69
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: ok
Registry Registrant ID: C121624169-LROR
Registrant Name: Mark Houts
Registrant Organization: HighWire Press
Registrant Street: Stanford University
Registrant Street: 1454 Page Mill Rd.
Registrant City: Palo Alto
Registrant State/Province: Ca
Registrant Postal Code: 94304
Registrant Country: US
Registrant Phone: +1.6507255937
Registrant Phone Ext:
Registrant Fax: +1.6507259335
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C121624168-LROR
Admin Name: Mark Houts
Admin Organization: HighWire Press
Admin Street: Stanford University
Admin Street: 1454 Page Mill Rd.
Admin City: Palo Alto
Admin State/Province: Ca
Admin Postal Code: 94304
Admin Country: US
Admin Phone: +1.6507255937
Admin Phone Ext:
Admin Fax: +1.6507259335
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C121624171-LROR
Tech Name: Mark Houts
Tech Organization: HighWire Press
Tech Street: Stanford University
Tech Street: 1454 Page Mill Rd.
Tech City: Palo Alto
Tech State/Province: Ca
Tech Postal Code: 94304
Tech Country: US
Tech Phone: +1.6507255937
Tech Phone Ext:
Tech Fax: +1.6507259335
Tech Fax Ext:
Tech Email: Login to show email
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form:
>>> Last update of WHOIS database: 2017-08-28T16:16:21Z

Who hosts is hosted by Stanford University in California, Stanford, United States, 94305. has an IP Address of and a hostname of Web Server Information

Hosted IP Address:
Service Provider:Stanford University
Hosted Country:United StatesUS
Location Latitude:37.4213
Location Longitude:-122.164
Webserver Software:Not Applicable

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 18 Jun 2015 17:13:55 GMT
Server: Apache/2.2.3 (CentOS)
Expires: Sun, 19 Nov 1978 05:00:00 GMT
Last-Modified: Thu, 18 Jun 2015 17:13:55 GMT
Cache-Control: no-cache, must-revalidate, post-check=0, pre-check=0
ETag: "1434647635"
X-Highwire-Cache: no-cache
Content-Language: en
X-Generator: Drupal 7 (
Vary: Accept-Encoding
Content-Encoding: gzip
X-Highwire-Sitecode: roysoc
Content-Length: 7253
Connection: close
Content-Type: text/html; charset=utf-8

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

openyears0royalavailablestatus openphilosophical transactionsethicshistory of scienceaccess options availablesciences researchmoresciences themed issuessciencephysicalfellows directoryrss feedsbiological sciencesaccess status openjournal publishingfrsissuesmedicalbsciences themedclimatecellularawardsnewsciencesenvironmentalauthorcomputerauthorsbiographicaljavascripthealthhistoryphilosophicalacrosseditorinchief professorthemed issuessubjectjournalsproceedingsfrs accessmathematicalpublishinggrantstheoryscientificphysical sciencesauthors librarianssystemscenturymathematicstechnologystatusinterfaceconnectdirectorylife sciencesemail alertsshowcompetitionlibrariansviewreviewsaccessfeedsphysicsbenefitsthemedresearch and reviewseditorinchiefaccess optionssciences editorinchief professorfastmechanicsgovernanceallfellowsbiologychemicaleventssocietycomputationalbiologicalsignquantumemailsearchlifecrossdisciplinaryroyal societysciences editorinchiefopen access optionsbiophysicsyoursign upalertsmemoirscentury scienceupdatesoptions availableresearchprofessorinternationalmolecularfundingourstatus open accessusaccess statusfrs access statusopen scienceaugustjournalupopen accesschemistrycontentrssoptionstransactionslife sciences editorinchiefhighpoliciescomputingengineeringenergy

Longtail Keyword Density for

frs access status9
status open access8
access options available8
open access options8
access status open8
sciences editor-in-chief professor6
research and reviews4
history of science3
sciences themed issues3
life sciences editor-in-chief3
open access14
access status10
editor-in-chief professor10
royal society9
frs access9
status open8
access options8
options available8
sciences editor-in-chief6
century science6
sign up5
sciences research4
philosophical transactions4
open science4
fellows directory4
themed issues4
journal publishing4
life sciences4
email alerts3
rss feeds3
sciences themed3
authors librarians3
biological sciences3
physical sciences3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry States United States States United States States United States States United States Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?