Rstyle.me  |  rewardStyle
High trust score  | 
rewardStyle is an invitation-only web tool that helps top tier style publishers find and monetize their content.

Rstyle.me Website Information

Rstyle.me has a High trust score, a Statvoo Rank of B, an Alexa Rank of 4,980, a Majestic Rank of 13,058, a Domain Authority of 62% and is not listed in DMOZ.

Rstyle.me is hosted by Amazon.com, Inc. in Dublin City, Dublin, Ireland, D8.
Rstyle.me has an IP Address of 176.34.248.71 and a hostname of ec2-176-34-248-71.eu-west-1.compute.amazonaws.

The domain rstyle.me was registered 8 years 6 months 1 week ago by doMEn, it was last modified 4 years 6 months 4 weeks ago and currently is set to expire 3 years 6 months 2 weeks ago.


Who hosts Rstyle.me?

Rstyle.me Web Server Information

Hosted IP Address:176.34.248.71
Hosted Hostname:ec2-176-34-248-71.eu-west-1.compute.amazonaws
Service Provider:Amazon.com, Inc.
Hosted Country:IrelandIE
Location Latitude:53.344
Location Longitude:-6.26719
Webserver Software:Not Applicable

HTTP Header Analysis for Rstyle.me

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Content-Encoding: gzip
Content-Type: text/html; charset=UTF-8
Date: Mon, 08 Jun 2015 20:40:58 GMT
Server: Apache
Vary: Accept-Encoding,User-Agent
Content-Length: 11363
Connection: keep-alive


Need to find out who hosts Rstyle.me?

Rstyle.me Free SEO Report

Website Inpage Analysis for Rstyle.me

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Rstyle.me

rarr influencerscampaignyorkaround the worlddallasworldwidehistorical retailthanpartnersfeaturedpleasechannelsproductsdistributionpremierchiefliketoknowitbrandcontentcreateredirectapply0youfunctionprovides influencersscaleexclusivelarrnullhashelsefirstachievesociallookingreachstrategicdocumentreadyfunctionvarsinceworldsrarrchannelconsumersoriginaltextjavascriptrewardstyle influencerusleverageretailtheyinfluencer contentinstagramperformance datainfluencersplatformsamberteamapplyendtoendlarr rarrbrandstargetedtruerewardstyle brandsbeensanpromotionmarketingconsultingverticalsmonetizationonlyinfluencercompanybnetworkreturn falsereturnhas beenprovidesbasicrewardstylesglobalpagehasrewardstyle influencersfalsescrolltimeoutsuccessinfluencebrands rewardstyleheighttimesofficeritsattachmillionmonthnew yorkopportunitiesawarenessperformanceemailfourlanguagedataaroundintoshanghaimobileacrossreadytoshopsitesthroughcontent monetizationapply nowplatformgoalsbrandingdigitalmoreinsightsyourpublishingstylenewdigital contenttechrelationshipsnavuniquemediarewardstylecomfashionnbspdrivealltheirinfluentialalignmentkeycampaignsrewardstyle teamtechnologysuiteboxifstyle influencersjoinrewardstyle mediatrafficcontinuerewardstylepressstrategic consultingscrollmore thanmostworldfunction varlondonpublishersyearsindustryhistoricalretail and brandingnowworlds mostinvitationonlysales1logaccessbusinessbloggers

Longtail Keyword Density for Rstyle.me

KeywordsOccurences
around the world4
retail and branding3
rewardstyle media10
rewardstyle team8
rewardstyle influencers7
more than7
apply now6
new york5
larr rarr5
has been4
rewardstyle brands4
function var4
digital content3
brands rewardstyle3
return false3
influencer content3
historical retail3
style influencers3
content monetization3
rewardstyle influencer3
rarr influencers3
strategic consulting3
performance data3
provides influencers3
worlds most3
rewardstyle61
influencers39
brands26
content26
liketoknowit21
influencer16
media14
more14
var14
nbsp11
has11
team11
retail11
rewardstyles10
global10
platform10
if10
hash10
their10
rarr10
apply10
network9
brand9
function9
sales8
digital8
across8
marketing8
new7
than7
now7
business7
world7
through7
social6
provides6
press6
most6
your6
drive6
performance6
monetization6
style6
instagram5
campaign5
strategic5
million5
success5
technology5
london5
fashion5
york5
mobile5
only5
else5
end-to-end5
email5
false5
access5
nav5
log5
leverage5
channels5
larr5
true5
branding4
documentreadyfunction4
unique4
been4
products4
san4
data4
join4
dallas4
height4
promotion4
ready-to-shop4
partners4
achieve4
null4
its4
box4
influence4
invitation-only4
verticals4
worldwide4
you4
04
original4
around4
channel4
scrolltimeout4
language4
consumers4
publishing4
targeted4
redirectapply3
campaigns3
company3
awareness3
textjavascript3
sites3
attach3
scroll3
officer3
amber3
chief3
bloggers3
us3
return3
featured3
b3
shanghai3
suite3
opportunities3
platforms3
distribution3
consulting3
alignment3
create3
month3
reach3
relationships3
tech3
scale3
basic3
rewardstylecom3
all3
first3
please3
page3
continue3
traffic3
four3
influential3
premier3
worlds3
exclusive3
13
goals3
looking3
industry3
insights3
since3
they3
times3
key3
years3
historical3
into3
publishers3

What are the nameservers for rstyle.me?

Rstyle.me Domain Nameserver Information

HostIP AddressCountry
ns-594.awsdns-10.net 205.251.194.82United States United States
ns-315.awsdns-39.com 205.251.193.59United States United States
ns-1777.awsdns-30.co.uk 205.251.198.241United States United States
ns-1515.awsdns-61.org 205.251.197.235United States United States

Rstyle.me Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Rstyle.me is a scam?