RTBF le site de la Radio Télévision Belge Francophone

Accédez à tous vos sites: L info, le sport, la météo, les vidéos, votre région, mais aussi, la TV, les radios et plein de concours exclusifs


Domain summary

SafetyHigh trust score
Year Founded
1996
Global Traffic Rank
4,250
Estimated Worth
$3,801,600
Last updated
2022-10-08
Domain label
rtbf
Domain extension
be
Domain registered:
1996-02-22
Domain updated:
2022-10-08
Statvoo Rating
B
Estimated daily income
$3,520
Estimated monthly income
$107,067

Frequently Asked Questions (FAQ)

Q: When was Rtbf.be registered?
A: Rtbf.be was registered 26 years, 9 months, 1 week, 4 days, 4 hours, 41 minutes, 14 seconds ago on Thursday, February 22, 1996.
Q: When was the WHOIS for Rtbf.be last updated?
A: The WHOIS entry was last updated 1 month, 3 weeks, 6 days, 4 hours, 41 minutes, 14 seconds ago on Saturday, October 8, 2022.
Q: What are Rtbf.be's nameservers?
A: DNS for Rtbf.be is provided by the following nameservers:
  • ns2.rtbf.be
  • ns1.rtbf.be
Q: Who is the registrar for the Rtbf.be domain?
A: The domain has been registered at DNS Belgium.
Q: What is the traffic rank for Rtbf.be?
A: Rtbf.be ranks 4,250 globally on Alexa. Rtbf.be has a High trust score, and a Statvoo Rank of B.
Q: How many people visit Rtbf.be each day?
A: Rtbf.be receives approximately 440,000 visitors and 3,520,000 page impressions per day.
Q: What IP address does Rtbf.be resolve to?
A: Rtbf.be resolves to the IPv4 address 151.101.1.63.
Q: In what country are Rtbf.be servers located in?
A: Rtbf.be has servers located in the United States.
Q: What webserver software does Rtbf.be use?
A: Rtbf.be is powered by webserver.
Q: Who hosts Rtbf.be?
A: Rtbf.be is hosted by Consortium GARR in United States.
Q: How much is Rtbf.be worth?
A: Rtbf.be has an estimated worth of $3,801,600. An average daily income of approximately $3,520, which is roughly $107,067 per month.

Rtbf.be Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Rtbf.be

H1 Headings

1 :
  1. Suivez-nous

H2 Headings

13 :
  1. À la Une
  2. Sport
  3. Retraite de Philippe Gilbert
  4. En continu
  5. Écoutez nos radios en direct
  6. Les Grenades et l'actu sur le genre
  7. Votre actu TV
  8. On en parle sur nos radios
  9. L'actu des médias
  10. Jouez et gagnez avec la RTBF
  11. Les plus populaires
  12. En direct à la télévision
  13. À voir sur Auvio

H3 Headings

109 :
  1. Guerre en Ukraine : l'armée ukrainienne résiste grâce aux armes russes
  2. Lenteur des procédures de divorce : la Ligue des familles attaque l’Etat belge en justice
  3. Direct - Guerre en Ukraine : 1,3 milliard de dollars débloqués pour l'Ukraine
  4. Expo à Mons : sous des airs enfantins, Joan Mirò capte l’essence des choses et de l’art ancien
  5. Enquête sur la disparition de Tanja Groen : en 1993, Dutroux était déjà un prédateur, condamné, puis libéré, et qui préparait la cache…
  6. Danemark : un Iranien armé d’un couteau arrêté à l’ambassade d’Iran
  7. Éducation sexuelle et affective à l’école : une lente (r)évolution
  8. Expo à Mons : sous des airs enfantins, Joan Mirò capte l’essence des choses et de l’art ancien
  9. Enquête sur la disparition de Tanja Groen : en 1993, Dutroux était déjà un prédateur, condamné, puis libéré, et qui préparait la cache…
  10. Danemark : un Iranien armé d’un couteau arrêté à l’ambassade d’Iran
  11. Éducation sexuelle et affective à l’école : une lente (r)évolution
  12. Budget de la Fédération Wallonie-Bruxelles : 150 millions pour l'énergie, la gratuité étendue aux 1re et 2e primaire dès 2023
  13. Budget de la Fédération Wallonie-Bruxelles : 150 millions pour l'énergie, la gratuité étendue aux 1re et 2e primaire dès 2023
  14. Redécouvrir Namur par son architecture contemporaine
  15. C’est la première rentrée des classes pour la Mosa Ballet School : excellence et bienveillance au programme de Liège en Prime
  16. Royaume-Uni : Liz Truss renvoie un ministre après une plainte pour "faute grave"
  17. Guerre en Ukraine : près de 2500 km2 de territoires libérés dans la dernière contre-offensive, selon Volodymyr Zelensky
  18. Redécouvrir Namur par son architecture contemporaine
  19. C’est la première rentrée des classes pour la Mosa Ballet School : excellence et bienveillance au programme de Liège en Prime
  20. Royaume-Uni : Liz Truss renvoie un ministre après une plainte pour "faute grave"
  21. Guerre en Ukraine : près de 2500 km2 de territoires libérés dans la dernière contre-offensive, selon Volodymyr Zelensky
  22. Shanti, victime des attentats de Bruxelles, euthanasiée à 23 ans pour souffrance psychique insupportable
  23. La campagne est lancée, les chiffres remontent: faut-il se faire revacciner contre le Covid-19 ?
  24. Jusqu'à 1600 euros pour un particulier : pourquoi les acomptes d'énergie explosent en octobre, alors que le cours du gaz est plutôt en baisse ?
  25. Les stocks de gaz remplis à 100% en Belgique : où en sont les autres pays européens ?
  26. Shanti, victime des attentats de Bruxelles, euthanasiée à 23 ans pour souffrance psychique insupportable
  27. La campagne est lancée, les chiffres remontent: faut-il se faire revacciner contre le Covid-19 ?
  28. Jusqu'à 1600 euros pour un particulier : pourquoi les acomptes d'énergie explosent en octobre, alors que le cours du gaz est plutôt en baisse ?
  29. Les stocks de gaz remplis à 100% en Belgique : où en sont les autres pays européens ?
  30. Des Ardennes au monde en passant sur les pavés : retour sur les cinq succès qui ont forgé la légende de Philippe Gilbert
  31. Direct vidéo - F1 Japon : Leclerc peut-il empêcher Verstappen d’être champion ce week-end ? Suivez les qualifications
  32. L'Antwerp s'impose au petit trot contre Saint-Trond et s'offre une dixième victoire en onze journées de Pro League
  33. Isaac Mbenza passe sur le Gril avant Charleroi - Standard : "Je sais ce que je dois faire pour revenir au top"
  34. Wout van Aert sur Philippe Gilbert : "A Roubaix j’ai vu à quel point il avait la classe"
  35. Mbappé devient le footballeur le mieux payé au monde selon Forbes, Hazard et De Bruyne dans le Top 10
  36. Roger Federer - La réunion : un documentaire sur son voyage et son match de gala face à Rafael Nadal sur les terres de sa mère, en Afrique du Sud
  37. Tour de Lombardie : le dernier monument de la saison, l’heure des adieux (direct commenté et vidéo 10h)
  38. Nausées, anxiété... Edinson Cavani a eu recours à un psychologue après la remontada du Barça en 2017
  39. Wout van Aert sur Philippe Gilbert : "A Roubaix j’ai vu à quel point il avait la classe"
  40. Philippe Gilbert avant ses adieux à Paris-Tours : "Je me sens prêt à arrêter, mais je veux jouer un rôle dans le final !"
  41. Philippe Gilbert, l'homme aux 80 victoires
  42. Remco Evenepoel sur Philippe Gilbert : "C’est le plus grand champion dans le peloton aujourd’hui"
  43. Superbiker de Mettet : 35e anniversaire ce week-end pour ce fleuron du Sport Moto belge !
  44. Willy est gardien d’une forêt exceptionnelle, en bordure de Bruxelles : "J’ai ce privilège incroyable d’y habiter"
  45. Direct vidéo - F1 Japon : Leclerc peut-il empêcher Verstappen d’être champion ce week-end ? Suivez les qualifications
  46. C’est la première rentrée des classes pour la Mosa Ballet School : excellence et bienveillance au programme de Liège en Prime
  47. Direct - Guerre en Ukraine : 1,3 milliard de dollars débloqués pour l'Ukraine
  48. Quand les hommes sort(ai)ent pour baiser
  49. Le Nobel de littérature 2022 récompense la Française Annie Ernaux
  50. Le populisme et les femmes : quels dangers ?
  51. Féminicide de Delphine K. : une minute de silence pour son meurtrier organisée dans une école de Charleroi
  52. En Belgique, une jeune fille sur deux se sent incomprise par les responsables politiques
  53. Sanae Saadaoui : "Nous avons besoin des femmes en informatique"
  54. "Toute une moitié du monde" d’Alice Zeniter, ou le besoin de représentations féminines
  55. Neema Namadamu : une femme de paix dans une région de conflits
  56. In Sandra Zidani We Trust, l’humour pour raconter le monde
  57. C'est du Belge : Concours Paris-Match 07.10
  58. "À visage dévoilé" – le combat de Masih Alinejad : un documentaire puissant sur la situation des femmes en Iran
  59. Roméo & Juliette s’emparent du Théâtre Royal du Parc de Bruxelles
  60. Ange-Victoria, le nouveau visage de "gotha" aux côtés de Patrick Weber
  61. La playlist du samedi 08 octobre : les nouveautés
  62. Christian Clavier participera au Festival International du Film de Comédie de Liège
  63. Prix Nobel : d’où viennent ces récompenses ?
  64. La Corée du Nord est-elle une vraie menace ?
  65. Arts, sport et business : « sky is the limit » en Californie !
  66. Coronavirus : "Vaccinons aussi les personnes de moins de 50 ans si ça permet de passer l’hiver plus tranquillement" explique Marius Gilbert
  67. Hommage à Elizabeth II : ces images que vous ne pourrez pas revoir sur la RTBF… parce que Buckingham l’interdit !
  68. La campagne de CAP 48 fait-elle trop de bruit ?
  69. "Un reportage à vélo par jour" : que fait la RTBF pour tenter de limiter ses émissions de CO2 ?
  70. "Pas le moindre reportage sur le mariage de la fille de la princesse Astrid, seriez-vous antiroyaliste ?" : dans les coulisses des choix du JT
  71. Pour Patrice, « La RTBF ne devrait pas retransmettre la coupe du monde de football 2022 »
  72. Quand un "vieux" contenu web resurgit : hasard ou recyclage ?
  73. La Tour Reyers : 4000 tonnes sur un pilier en béton, symbole de la RTBF et de la VRT
  74. "Et si vous nous disiez la vérité sur la guerre en Ukraine" : quelle influence de l'OTAN sur les journalistes?
  75. Réseaux sociaux : ces bots que vous croisez sans le savoir
  76. Petit tour dans les coulisses du JT de la RTBF avec Ophélie Fontana et Laurent Mathieu
  77. C'est du Belge : Concours Paris-Match 07.10
  78. Concerts : Béesau, Magenta, Julien Granel et Jok'air sont bientôt au Botanique – Remportez vos places
  79. Le réveil de Tipik vous offre des baptêmes de chute libre et des sessions de jeux de réalité virtuelle.
  80. La Trois vous invite à l’expo "Joan Miró. L’essence des choses passées et présentes"
  81. Vos entrées pour le WHAFF
  82. Le Jardin Extraordinaire et le Festival International Nature de Namur vous offrent des places, des cadeaux et des photos...
  83. Vos entrées pour un concert au Festival des Libertés
  84. Vos places pour le concert de Bob Dylan à Forest National le 15/10
  85. Vos places pour le concert de -M- à Forest National le 14/10
  86. Crise énergétique : Paul Magnette (PS) prône une "cotisation de crise" pour les très hauts salaires
  87. Wout van Aert sur Philippe Gilbert : "A Roubaix j’ai vu à quel point il avait la classe"
  88. Le gouvernement wallon n'investira pas dans NewB : clap de fin "très probable" pour sa licence bancaire
  89. Marathon de la vitesse : la police constate des infractions plus nombreuses et plus graves
  90. Le gouvernement wallon détaille son accord sur le budget 2023 : des mesures concrètes à court, moyen et long terme
  91. L’argent, les ministres et la réalité
  92. Viva Week-end
  93. Formule 1 - Les Qualifications
  94. Pat' Patrouille
  95. En cuisine
  96. Demain nous appartient
  97. Pyjamasques
  98. Bouge à la maison
  99. Léonard de Vinci l'homme universel
  100. Les Rothschild - Ascension et tribulations d'une famille
  101. Meurtres à Colmar
  102. Crimes et Indices
  103. Jamie Lee Curtis. Un cri de liberté à Hollywood
  104. C'est du belge
  105. Météo 20h00
  106. JT 19h30
  107. Vews
  108. Déclic
  109. Cap news

H4 Headings

89 :
  1. Guerre en Ukraine
  2. Guerre en Ukraine
  3. Regions Hainaut
  4. Justice
  5. Monde
  6. Belgique
  7. Regions Hainaut
  8. Justice
  9. Monde
  10. Belgique
  11. Belgique
  12. Belgique
  13. Actualités locales
  14. Audio
  15. Monde
  16. Guerre en Ukraine
  17. Actualités locales
  18. Audio
  19. Monde
  20. Guerre en Ukraine
  21. Investigation
  22. Coronavirus
  23. Prix de l'énergie
  24. Economie
  25. Investigation
  26. Coronavirus
  27. Prix de l'énergie
  28. Economie
  29. Vidéo
  30. Moteurs Formule 1
  31. Vidéo
  32. Jupiler Pro League
  33. Cyclisme
  34. Ligue 1 - Football
  35. Vidéo
  36. Cyclisme
  37. Champions League - Foot
  38. Cyclisme
  39. Cyclisme
  40. Audio
  41. Vidéo
  42. Moteurs
  43. Vidéo
  44. Moteurs Formule 1
  45. Audio
  46. Guerre en Ukraine
  47. Les Grenades
  48. Littérature
  49. Les Grenades
  50. Les Grenades
  51. Belgique
  52. Les Grenades
  53. Les Grenades
  54. Les Grenades
  55. Les Grenades
  56. C'est du Belge
  57. La Trois
  58. Vidéo
  59. Gotha
  60. Sacré Français
  61. Cinéma
  62. Audio
  63. OPFP
  64. Belges du bout du monde
  65. OPFP
  66. Inside
  67. Inside
  68. Inside
  69. Inside
  70. Inside
  71. Vidéo
  72. Inside
  73. Inside
  74. Inside
  75. C'est du Belge
  76. Concours
  77. Concours
  78. Concours avec dotation
  79. Concours avec dotation
  80. Le Jardin extraordinaire
  81. Concours avec dotation
  82. Concours avec dotation
  83. Concours avec dotation
  84. Belgique
  85. Cyclisme
  86. Economie
  87. Mobilité
  88. Economie
  89. Chroniques

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

434 :

Links - Internal

182:

Links - Internal (nofollow)

0:

Links - Outbound

8:

Links - Outbound (nofollow)

0:

Longtail Keyword Density for Rtbf.be

KeywordsOccurrences
couter en replay42
et en replay25
replay sur auvio25
gratuitement en streaming23
sur auvio des20
replay les missions15
streaming sur auviodescriptiondcouvrez12
replay les documentaires12
sur philippe gilbert12
replay les programmes11
auviodescriptiondcouvrez toute loffre10
sur auviodescriptiondcouvrez toute10
sur auviodescriptiondcouvrez loffre10
van aert sur9
cri de libert9
curtis un cri9
lee curtis un9
aert sur philippe9
quel point il9
point il avait9
toutes les missions9
roubaix jai vu9
jai vu quel9
vu quel point9
gratuitement sur auviodescriptiondcouvrez8
auviodescriptiondcouvrez loffre documentaire8
loffre documentaire disponible8
documentaire disponible gratuitement8
replay gratuitement sur8
replay et streaming8
auvio des docus8
encore dinvestigation tout8
revoir les documentaires8
ou revoir les8
streaming gratuitdescriptionretrouvez gratuitement8
le site rtbf8
sur le site8
dinvestigation tout y8
ou encore dinvestigation8
des docus animaux8
people ou encore8
historique people ou8
nature historique people8
seotitledocumentaires en streaming8
animaux et nature8
docus animaux et8
et nature historique8
tout y est8
guerre en ukraine8
et replay sur8
streaming et replay8
mosa ballet school7
et toutes les7
streaming gratuit sur7
rothschild ascension et7
lessence des choses7
ascension et tribulations7
programme de lige7
bienveillance au programme7
et bienveillance au7
excellence et bienveillance7
school excellence et7
ballet school excellence7
pour la mosa7
rentre des classes7
premire rentre des7
des classes pour7
leclerc peut-il empcher6
jamie lee curtis6
dollars dbloqus pour6
verstappen dtre champion6
places pour le6
empcher verstappen dtre6
peut-il empcher verstappen6
ukraine 13 milliard6
au bord du6
milliard de dollars6
japon leclerc peut-il6
dans les coulisses6
vido f1 japon6
f1 japon leclerc6
site rtbf auvio6
dtre champion ce6
ce week-end suivez6
pour le concert6
belge concours paris-match6
champion ce week-end6
federer la runion6
du belge concours6
week-end suivez les6
gilbert a roubaix6
forest national le6
sur la vie6
tous les journaux5
les programmes du0026039info5
rtbf seotitleinfo jt5
replay les sries5
seotitleinfo jt mto5
les journaux tlviss5
les missions info5
et missions dinfos5
auvio tous les5
jt mto et5
mto et missions5
sur auvio tous5
info disponible gratuitement5
loffre info disponible5
toute loffre info5
dinfos en streaming5
ancestorsid31labeldocumentairesdescriptionvoir ou couter5
mto et toutes5
disponible en streaming5
descriptiondcouvrez toute loffre5
auvio des dizaines5
voir gratuitement quand5
auvio descriptiondcouvrez toute5
gratuitement quand vous5
quand vous le5
vous le voulez5
sur auvio descriptiondcouvrez5
gratuit sur auvio5
et tribulations dune5
rtbf ancestorsid31labeldocumentairesdescriptionvoir ou5
dans le monde5
prs de 25005
tlviss la mto5
iranien arm dun5
arm dun couteau5
accord sur le4
coupe du monde4
sur le budget4
replay les films4
le budget 20234
cinq ans plus4
ans plus tard4
et les femmes4
nobel de littrature4
missions de sciencessant4
une personnalit ou4
les coulisses du4
runion un documentaire4
mieux pay au4
avant une personnalit4
personnalit ou un4
ou un style4
un style musical4
mettant en avant4
les documentaires mettant4
pay au monde4
le mieux pay4
les documentaires traitant4
footballeur le mieux4
le footballeur le4
musiquedescriptionvoir ou revoir4
u0026 musiquedescriptionvoir ou4
festival international du4
international du film4
film de comdie4
dune actrice rsolument4
belge et internationale4
sur le gril4
liz truss renvoie4
lcole une lente4
fdration wallonie-bruxelles 1504
150 millions pour4
gratuit tendue aux4
tendue aux 1re4
aux 1re et4
1re et 2e4
et 2e primaire4
2e primaire ds4
namur par son4
par son architecture4
truss renvoie un4
et affective lcole4
renvoie un ministre4
un ministre aprs4
ministre aprs une4
aprs une plainte4
une plainte pour4
y a 114
km2 de territoires4
territoires librs dans4
dans la dernire4
dernire contre-offensive selon4
contre-offensive selon volodymyr4
victime des attentats4
affective lcole une4
sexuelle et affective4
bruxelles euthanasie 234
tanja groen en19934
airs enfantins joan4
des airs enfantins4
sous des airs4
enfantins joan mir4
joan mir capte4
mir capte lessence4
mons sous des4
capte lessence des4
des choses et4
et de lart4
sur la disparition4
disparition de tanja4
groen en1993 dutroux4
couteau arrt lambassade4
en1993 dutroux tait4
dutroux tait dj4
tait dj un4
dj un prdateur4
un prdateur condamn4
prdateur condamn puis4
condamn puis libr4
puis libr et4
libr et qui4
et qui prparait4
un iranien arm4
dun couteau arrt4
attentats de bruxelles4
wallonie-bruxelles 150 millions4
euthanasie 23 ans4
y a 14
explosent en octobre4
octobre alors que4
alors que le4
le cours du4
cours du gaz4
du gaz est4
gaz est plutt4
stocks de gaz4
particulier pourquoi les4
lactualit belge et4
rfrence de lactualit4
gaz remplis 1004
23 ans pour4
100 en belgique4
o en sont4
sont les autres4
pourquoi les acomptes4
que le cours4
un particulier pourquoi4
faut-il se faire4
ans pour souffrance4
pour souffrance psychique4
campagne est lance4
est lance les4
lance les chiffres4
les chiffres remontent4
chiffres remontent faut-il4
remontent faut-il se4
pour un particulier4
les autres pays4
se faire revacciner4
replay les journaux4
euros pour un4
1600 euros pour4
faire revacciner contre4
revacciner contre le4
places des cadeaux3
sur la guerre3
pour un concert3
croisez sans le3
disiez la vrit3
vous croisez sans3
un concert au3
entres pour un3
des cadeaux et3
cadeaux et des3
sociaux ces bots3
ces bots que3
que vous croisez3
dizaines de sries3
bots que vous3
concert de -m-3
concert au festival3
tour dans les3
tonnes sur un3
pour les trs3
ps prne une3
magnette ps prne3
paul magnette ps3
nergtique paul magnette3
-m- forest national3
sur un pilier3
au festival des3
dylan forest national3
pilier en bton3
si vous nous3
bob dylan forest3
concert de bob3
vous nous disiez3
loffre sries disponible3
sries en intgralit3
mir lessence des3
intgralit voir gratuitement3
botanique remportez vos3
baptmes de chute3
avec ophlie fontana3
ophlie fontana et3
offre des baptmes3
vous offre des3
tipik vous offre3
rveil de tipik3
au botanique remportez3
libre et des3
bientt au botanique3
sont bientt au3
julien granel et3
pas dans newbclap3
fontana et laurent3
magenta julien granel3
besau magenta julien3
chute libre et3
et des sessions3
des places des3
extraordinaire et le3
offrent des places3
vous offrent des3
namur vous offrent3
nature de namur3
festival international nature3
le festival international3
et le festival3
jardin extraordinaire et3
sessions de jeux3
entres pour le3
choses passes et3
coulisses du jt3
rtbf avec ophlie3
des choses passes3
trois vous invite3
jeux de ralit3
les trs hauts3
rvrence le coureur3
newbclap de fin3
des reportages et3
portrait dune actrice3
reyers 4000 tonnes3
seotitlesries en streaming3
temps dune histoire3
des documentaires sur3
et des documentaires3
reportages et des3
missions des reportages3
ancestorsid1labelinfodescriptionvoir ou couter3
des missions des3
auvio des missions3
toute loffre sries3
lifestyle disponible gratuitement3
loffre lifestyle disponible3
toute loffre lifestyle3
quotidienne en streaming3
et reportages sur3
rtbf ancestorsid1labelinfodescriptionvoir ou3
sries et websries3
nseotitlelifestyle vidos et3
un regard diffrent3
informe de lactualit3
des vidos dactualit3
vidos dactualit destines3
au web elles3
web elles apportent3
elles apportent un3
apportent un regard3
regard diffrent sur3
les sries et3
diffrent sur linfo3
sur linfo avec3
linfo avec un3
avec un ton3
un ton direct3
ton direct et3
direct et authentique3
une toute nouvelle3
vidos et reportages3
rtbf nseotitlelifestyle vidos3
pour sa licence3
dtaille son accord3
court moyen et3
concrtes court moyen3
mesures concrtes court3
des mesures concrtes3
2023 des mesures3
budget 2023 des3
son accord sur3
wallon dtaille son3
les ministres et3
gouvernement wallon dtaille3
nombreuses et plus3
plus nombreuses et3
infractions plus nombreuses3
des infractions plus3
constate des infractions3
police constate des3
vitesse la police3
moyen et long3
pierre arditi et3
missions de vie3
le coureur wallon3
manzul et malik3
fait rver plusieurspublishedfrom2022-10-07t1712470200publicationdate2022-10-07t1712470200majorupdatedat2022-10-07t1712470200readingduration13
professionnelles a fait3
80 victoires professionnelles3
aux 80 victoires3
wallon aux 803
coureur wallon aux3
jt de 19h303
arditi et garance3
sa rvrence le3
tir sa rvrence3
gilbert a tir3
avait la classeimageurlxshttpsdsstaticrtbfbearticleimage180x100b3026d0975bec8affe658ceb2b620b1b74ajpgshttpsdsstaticrtbfbearticleimage370x208b3026d0975bec8affe658ceb2b620b1b74ajpgmhttpsdsstaticrtbfbearticleimage770x433b3026d0975bec8affe658ceb2b620b1b74ajpglhttpsdsstaticrtbfbearticleimage1248x702b3026d0975bec8affe658ceb2b620b1b74ajpgxlhttpsdsstaticrtbfbearticleimage1920x1080b3026d0975bec8affe658ceb2b620b1b74ajpgsummaryphilippe3
classeimagealtwout van aert3
avait la classeimagealtwout3
o en sommes-nous3
plus tard o3
4000 tonnes sur3
ukrainienne rsiste grce3
tour reyers 40003
remontada du bara3
un rle dans3
jouer un rle3
veux jouer un3
je veux jouer3
mais je veux3
arrter mais je3
prt arrter mais3
sens prt arrter3
me sens prt3
ses adieux paris-tours3
avant ses adieux3
gilbert avant ses3
minvoir tout sur3
aprs la remontada3
dans le final3
un psychologue aprs3
recours un psychologue3
eu recours un3
cavani a eu3
anxit edinson cavani3
comment et vido3
direct comment et3
adieux direct comment3
des adieux direct3
lheure des adieux3
saison lheure des3
le dernier monument3
lombardie le dernier3
mre en afrique3
rle dans le3
evenepoel sur philippe3
sur les terres3
gardien dune fort3
le nerlandais na3
si le nerlandais3
2 si le3
numro 2 si3
tentative numro 23
monde tentative numro3
du monde tentative3
champion du monde3
verstappen champion du3
privilge incroyable dy3
ce privilge incroyable3
bordure de bruxelles3
exceptionnelle en bordure3
dune fort exceptionnelle3
est gardien dune3
le plus grand3
y a 23
du sport moto3
fleuron du sport3
ce fleuron du3
pour ce fleuron3
week-end pour ce3
ce week-end pour3
anniversaire ce week-end3
35e anniversaire ce3
mettet 35e anniversaire3
dans le peloton3
champion dans le3
grand champion dans3
plus grand champion3
terres de sa3
nadal sur les3
na pas russi3
retour sur les3
victoire en onze3
une dixime victoire3
contre saint-trond et3
trot contre saint-trond3
petit trot contre3
au petit trot3
lgende de philippe3
forg la lgende3
qui ont forg3
succs qui ont3
cinq succs qui3
les cinq succs3
sur les cinq3
pavs retour sur3
mbenza passe sur3
les pavs retour3
sur les pavs3
passant sur les3
monde en passant3
ardennes au monde3
y a 213
y a 93
attaque letat belge3
familles attaque letat3
des familles attaque3
ligue des familles3
divorce la ligue3
procdures de divorce3
grce aux armes3
journes de pro3
passe sur le3
rafael nadal sur3
monde selon forbes3
face rafael nadal3
gala face rafael3
match de gala3
et son match3
voyage et son3
son voyage et3
sur son voyage3
documentaire sur son3
un documentaire sur3
dans le top3
bruyne dans le3
et de bruyne3
forbes hazard et3
selon forbes hazard3
au monde selon3
le gril avant3
devient le footballeur3
avait la classequotcyclismehier3
quota roubaix jai3
gilbert quota roubaix3
philippe gilbert quota3
pour revenir au3
faire pour revenir3
dois faire pour3
je dois faire3
que je dois3
ce que je3
sais ce que3
avant charleroi standard3
gril avant charleroi3
nerlandais na pas3
pas russi officialiser3
resurgit hasard ou3
nord est-elle une3
ii ces images3
elizabeth ii ces3
passer lhiver plus3
permet de passer3
si a permet3
50 ans si3
moins de 503
personnes de moins3
aussi les personnes3
du bout du3
et business sky3
sport et business3
est-elle une vraie3
du nord est-elle3
images que vous3
core du nord3
do viennent ces3
nobel do viennent3
au festival international3
participera au festival3
clavier participera au3
08 octobre les3
samedi 08 octobre3
du samedi 083
playlist du samedi3
cts de patrick3
le nouveau visage3
royal du parc3
thtre royal du3
ces images que3
que vous ne3
semparent du thtre3
moindre reportage sur3
web resurgit hasard3
contenu web resurgit3
monde de football3
retransmettre la coupe3
devrait pas retransmettre3
ne devrait pas3
rtbf ne devrait3
patrice la rtbf3
des choix du3
coulisses des choix3
les coulisses des3
princesse astrid seriez-vous3
sur le mariage3
reportage sur le3
le moindre reportage3
vous ne pourrez3
limiter ses missions3
tenter de limiter3
rtbf pour tenter3
fait la rtbf3
reportage vlo par3
48 fait-elle trop3
cap 48 fait-elle3
campagne de cap3
parce que buckingham3
rtbf parce que3
sur la rtbf3
pas revoir sur3
pourrez pas revoir3
ne pourrez pas3
du thtre royal3
juliette semparent du3
russi officialiser sa3
ukraine ce vendredi3
organise dans une3
meurtrier organise dans3
son meurtrier organise3
pour son meurtrier3
silence pour son3
minute de silence3
k une minute3
delphine k une3
les femmes quels3
populisme et les3
rcompense la franaise3
littrature 2022 rcompense3
hommes sortaient pour3
les hommes sortaient3
russe en ukraine3
belgique une jeune3
jour de guerre3
le 227e jour3
marque le 227e3
samedi marque le3
cloedt rpond sans3
benjamine de cloedt3
du bolcho benjamine3
fournisseur du bolcho3
devenir fournisseur du3
est de devenir3
son ambition est3
si son ambition3
savoir si son3
question de savoir3
dans une cole3
une jeune fille3
situation des femmes3
femme de paix3
rsiste grce aux3
documentaire puissant sur3
un documentaire puissant3
alinejad un documentaire3
masih alinejad un3
combat de masih3
pour raconter le3
lhumour pour raconter3
trust lhumour pour3
we trust lhumour3
zidani we trust3
sandra zidani we3
dans une rgion3
paix dans une3
namadamu une femme3
jeune fille sur3
besoin de reprsentations3
ou le besoin3
zeniter ou le3
dalice zeniter ou3
une moiti du3
besoin des femmes3
avons besoin des3
par les responsables3
incomprise par les3
sent incomprise par3
se sent incomprise3
deux se sent3
sur deux se3
fille sur deux3
sur la situation3
replay les57
ou couter42
streaming et31
sur auvio30
replay sur25
sur le25
les missions24
disponible gratuitement20
les documentaires20
auvio des20
sur auviodescriptiondcouvrez20
dans le19
toute loffre15
oct 202215
sur les14
philippe gilbert14
lee curtis13
du monde13
sur philippe12
streaming sur12
toutes les11
les programmes11
et des10
mto et10
auviodescriptiondcouvrez toute10
pour le10
streaming gratuitdescriptionretrouvez10
auviodescriptiondcouvrez loffre10
les journaux9
aert sur9
il avait9
van aert9
dans une9
point il9
et les9
curtis un9
un cri9
quel point9
vu quel9
jai vu9
roubaix jai9
tous les9
pour un9
du belge9
ce week-end9
et missions9
documentaire disponible8
people ou8
historique people8
nature historique8
et nature8
encore dinvestigation8
animaux et8
docus animaux8
des docus8
revoir les8
dinvestigation tout8
loffre documentaire8
et replay8
tout y8
site rtbf8
le site8
gratuitement sur8
replay gratuitement8
rtbf seotitledocumentaires8
et streaming8
y est8
ou revoir8
streaming gratuit8
replay et8
ou encore8
des choses8
dans les8
pour les8
gratuitdescriptionretrouvez gratuitement8
excellence et7
que le7
ascension et7
rothschild ascension7
ce vendredi7
festival international7
mais aussi7
et bienveillance7
que vous7
et toutes7
rtbf auvio7
gouvernement wallon7
un documentaire7
au monde7
lessence des7
places pour7
les coulisses7
et tribulations7
gratuit sur7
mosa ballet7
des femmes7
le monde7
school excellence7
au programme7
des classes7
bienveillance au7
premire rentre7
rentre des7
ballet school7
classes pour7
avec des7
aux 806
peut-il empcher6
leclerc peut-il6
japon leclerc6
dollars dbloqus6
f1 japon6
vido f16
des documentaires6
du sport6
national le6
forest national6
le concert6
temps dune6
bord du6
empcher verstappen6
sa mre6
suivez les6
13 milliard6
vie quotidienne6
dbloqus pour6
ukraine 136
week-end suivez6
champion ce6
entres pour6
dtre champion6
au festival6
verstappen dtre6
rafael nadal6
jamie lee6
et le6
au bord6
concours paris-match6
belge concours6
le voulez5
vous le5
programmes du0026039info5
info disponible5
jt mto5
tribulations dune5
plus grand5
loffre info5
les rothschild5
missions dinfos5
missions info5
auvio tous5
quand vous5
seotitleinfo jt5
rtbf seotitleinfo5
auvio descriptiondcouvrez5
descriptiondcouvrez toute5
des dizaines5
voir gratuitement5
journaux tlviss5
gratuitement quand5
les sries5
2500 km25
dun couteau5
pour sa5
du nord5
dj un5
fdration wallonie-bruxelles5
les autres5
aux cts5
du thtre5
actrice rsolument5
cinq ans5
liz truss5
aprs une5
iranien arm5
qui ne5
arm dun5
par les5
sont les5
avec dotationhier5
23 ans5
ancestorsid31labeldocumentairesdescriptionvoir ou5
rtbf ancestorsid31labeldocumentairesdescriptionvoir5
na pas5
missions des5
coulisses du4
et plus4
elizabeth ii4
cap 484
documentaires traitant4
chute libre4
au botanique4
des places4
edinson cavani4
paul magnette4
sept 20224
par le4
tout sur4
bob dylan4
tour reyers4
coupe du4
festival des4
ministres et4
accord sur4
et au4
les derniers4
les hommes4
littrature 20224
franaise annie4
les femmes4
delphine k4
pour son4
avec un4
avec dotationtitlevos4
le budget4
dans un4
roger federer4
we trust4
plus tard4
ans plus4
international du4
du film4
budget 20234
les films4
dune actrice4
et internationale4
se faire4
1600 euros4
est lance4
mir capte4
lance les4
les chiffres4
chiffres remontent4
remontent faut-il4
faut-il se4
sexuelle et4
faire revacciner4
revacciner contre4
et qui4
contre le4
euros pour4
campagne est4
un particulier4
particulier pourquoi4
pourquoi les4
les acomptes4
renvoie un4
joan mir4
octobre alors4
enfantins joan4
airs enfantins4
alors que4
truss renvoie4
le cours4
capte lessence4
choses et4
gaz est4
tait dj4
condamn puis4
ministre aprs4
une plainte4
plainte pour4
11 heures14
ukraine prs4
territoires librs4
librs dans4
puis libr4
un prdateur4
dernire contre-offensive4
contre-offensive selon4
dutroux tait4
tanja groen4
libr et4
selon volodymyr4
en1993 dutroux4
victime des4
groen en19934
des attentats4
bruxelles euthanasie4
euthanasie 234
ans pour4
pour souffrance4
un ministre4
souffrance psychique4
du gaz4
cours du4
est plutt4
affective lcole4
wallonie-bruxelles 1504
un iranien4
le footballeur4
couteau arrt4
footballeur le4
le mieux4
lactualit belge4
une lente4
mieux pay4
pay au4
lcole une4
le top4
runion un4
et affective4
gaz remplis4
belge et4
libert hollywood4
style musical4
un style4
ou un4
personnalit ou4
arrt lambassade4
une personnalit4
avant une4
documentaires mettant4
musiquedescriptionvoir ou4
u0026 musiquedescriptionvoir4
les grands4
150 millions4
millions pour4
gratuit tendue4
namur par4
remplis 1004
belgique o4
autres pays4
des airs4
retour sur4
sous des4
qui prparait4
ukraineil y4
mons sous4
par son4
son architecture4
primaire ds4
aux 1re4
le gril4
2e primaire4
tendue aux4
prdateur condamn4
1re et4
et 2e4
dans newbclap3
constate des3
wallon dtaille3
dtaille son3
plus nombreuses3
infractions plus3
police constate3
son accord3
des infractions3
pas dans3
trs hauts3
sa licence3
2023 des3
nombreuses et3
portrait dune3
les trs3
vous offre3
mir lessence3
vous invite3
trois vous3
des sessions3
magellan est3
libre et3
des baptmes3
offre des3
tipik vous3
passes et3
remportez vos3
botanique remportez3
bientt au3
sont bientt3
granel et3
julien granel3
magenta julien3
besau magenta3
choses passes3
ralit virtuelle3
prne une3
des cadeaux3
ps prne3
magnette ps3
nergtique paul3
-m- forest3
dylan forest3
concert au3
un concert3
cadeaux et3
places des3
et ralit3
offrent des3
vous offrent3
namur vous3
international nature3
le festival3
extraordinaire et3
jardin extraordinaire3
tout commence3
des mesures3
80 victoires3
mesures concrtes3
nous appartient3
un ton3
ton direct3
direct et3
et authentique3
une toute3
toute nouvelle3
les niouzz3
sries et3
sur linfo3
et websries3
rtbf seotitlesries3
loffre sries3
propose des3
dune histoire3
les plus3
documentaires sur3
reportages et3
linfo avec3
diffrent sur3
des missions3
lune des3
et un3
dominique aubry3
sur rtbf3
fontana et3
rtbf ancestorsid1labelinfodescriptionvoir3
ancestorsid1labelinfodescriptionvoir ou3
cet enfant3
son fils3
les jours3
regard diffrent3
des vidos3
vidos dactualit3
dactualit destines3
au web3
web elles3
elles apportent3
apportent un3
un regard3
des reportages3
lifestyle disponible3
concrtes court3
cest le3
le coureur3
rvrence le3
sa rvrence3
tir sa3
classeimageurlxshttpsdsstaticrtbfbearticleimage180x100b3026d0975bec8affe658ceb2b620b1b74ajpgshttpsdsstaticrtbfbearticleimage370x208b3026d0975bec8affe658ceb2b620b1b74ajpgmhttpsdsstaticrtbfbearticleimage770x433b3026d0975bec8affe658ceb2b620b1b74ajpglhttpsdsstaticrtbfbearticleimage1248x702b3026d0975bec8affe658ceb2b620b1b74ajpgxlhttpsdsstaticrtbfbearticleimage1920x1080b3026d0975bec8affe658ceb2b620b1b74ajpgsummaryphilippe gilbert3
classeimagealtwout van3
intgralit voir3
sa carrire3
larme ukrainienne3
wallon aux3
tard o3
et garance3
arditi et3
pierre arditi3
les ministres3
et long3
moyen et3
court moyen3
coureur wallon3
61 ans3
loffre lifestyle3
faire du3
reportages sur3
et reportages3
vidos et3
sries disponible3
nseotitlelifestyle vidos3
rtbf nseotitlelifestyle3
pour faire3
tout se3
et malik3
victoires professionnelles3
manzul et3
vous ont3
donnent rendez-vous3
le cinma3
ne se3
au cours3
rver plusieurspublishedfrom2022-10-07t1712470200publicationdate2022-10-07t1712470200majorupdatedat2022-10-07t1712470200readingduration13
fait rver3
et laurent3
ukrainienne rsiste3
ophlie fontana3
veux jouer3
pour ce3
week-end pour3
anniversaire ce3
35e anniversaire3
mettet 35e3
le peloton3
champion dans3
grand champion3
le plus3
evenepoel sur3
le final3
rle dans3
un rle3
jouer un3
je veux3
fleuron du3
gilbert avant3
recours un3
un psychologue3
psychologue aprs3
remontada du3
du bara3
minvoir tout3
avant ses3
mais je3
ses adieux3
adieux paris-tours3
me sens3
sens prt3
prt arrter3
arrter mais3
ce fleuron3
sport moto3
anxit edinson3
fournisseur du3
officialiser sa3
savoir si3
si son3
son ambition3
ambition est3
devenir fournisseur3
du bolcho3
pas russi3
bolcho benjamine3
cloedt rpond3
rpond sans3
samedi marque3
marque le3
le 227e3
russi officialiser3
nerlandais na3
aux etats-unis3
incroyable dy3
est gardien3
gardien dune3
dune fort3
fort exceptionnelle3
ce privilge3
privilge incroyable3
verstappen champion3
le nerlandais3
champion du3
monde tentative3
tentative numro3
numro 23
2 si3
si le3
eu recours3
et vido3
guerre depuis3
une dixime3
ont forg3
au petit3
petit trot3
trot contre3
contre saint-trond3
saint-trond et3
dixime victoire3
succs qui3
onze journes3
mbenza passe3
passe sur3
gril avant3
avant charleroi3
charleroi standard3
qui ont3
cinq succs3
ce que3
attaque letat3
grce aux3
aux armes3
des procdures3
ligue des3
des familles3
familles attaque3
letat belge3
les cinq3
21 minutes123
minla campagne3
ardennes au3
passant sur3
les pavs3
pavs retour3
sais ce3
que je3
comment et3
lombardie le3
son match3
gala face3
face rafael3
nadal sur3
les terres3
afrique du3
le dernier3
voyage et3
dernier monument3
saison lheure3
lheure des3
des adieux3
adieux direct3
direct comment3
et son3
son voyage3
je dois3
classequotcyclismehier 151213
dois faire3
faire pour3
pour revenir3
revenir au3
gilbert quota3
quota roubaix3
devient le3
sur son3
monde selon3
selon forbes3
forbes hazard3
hazard et3
bruyne dans3
documentaire sur3
227e jour3
ukraine ce3
avec ophlie3
parce que3
le mariage3
reportage sur3
moindre reportage3
le moindre3
ses missions3
limiter ses3
pour tenter3
rtbf pour3
que fait3
vlo par3
reportage vlo3
fait-elle trop3
48 fait-elle3
que buckingham3
rtbf parce3
astrid seriez-vous3
explique marius3
aussi les3
les personnes3
50 ans3
ans si3
passer lhiver3
lhiver plus3
ii ces3
revoir sur3
ces images3
images que3
vous ne3
ne pourrez3
pourrez pas3
pas revoir3
princesse astrid3
coulisses des3
du bout3
ces bots3
vous nous3
nous disiez3
vrit sur3
quelle influence3
juin 20223
sociaux ces3
bots que3
rtbf et3
vous croisez3
croisez sans3
sans le3
tour dans3
du jt3
rtbf avec3
si vous3
bton symbole3
des choix3
contenu web3
choix du3
rtbf ne3
ne devrait3
devrait pas3
pas retransmettre3
football 20223
web resurgit3
un pilier3
resurgit hasard3
hasard ou3
reyers 40003
4000 tonnes3
tonnes sur3
sur un3
bout du3
business sky3
dclarait avoir3
une moiti3
se sent3
sent incomprise3
incomprise par3
les responsables3
avons besoin3
besoin des3
moiti du3
sur deux3
dalice zeniter3
zeniter ou3
ou le3
le besoin3
namadamu une3
une femme3
deux se3
fille sur3
une rgion3
une minute3
hommes sortaient3
sortaient pour3
2022 rcompense3
populisme et3
femmes quels3
k une3
silence pour3
jeune fille3
son meurtrier3
meurtrier organise3
organise dans3
une cole3
belgique une3
une jeune3
paix dans3
sandra zidani3
et business3
nobel do3
du samedi3
rsiste grce3
08 octobre3
octobre les3
clavier participera3
participera au3
do viennent3
nouveau visage3
viennent ces3
core du3
nord est-elle3
est-elle une3
une vraie3
sport et3
playlist du3
le nouveau3
zidani we3
alinejad un3
trust lhumour3
lhumour pour3
pour raconter3
raconter le3
le combat3
masih alinejad3
documentaire puissant3
du parc3
puissant sur3
situation des3
juliette semparent3
semparent du3
thtre royal3
royal du3
samedi 083
et282
les221
le201
des169
sur163
du136
un113
pour105
replay103
rtbf97
au78
ou77
streaming74
une74
dans68
est54
son46
plus44
couter42
ce42
gratuitement42
missions40
vous37
auvio37
y37
avec36
que35
034
tout30
pas30
monde30
aux30
qui29
sa28
documentaires28
dune27
se25
gilbert25
disponible25
loffre25
par25
il23
philippe21
sont21
ne21
ans21
auviodescriptiondcouvrez20
toute19
ukraine18
belge18
nous18
documentaire18
mais17
faire16
oct15
ces15
rothschild15
lee14
dun14
temps14
jt14
octobre13
o13
vie13
famille13
curtis13
femmes13
deux13
gratuit13
avant13
si12
encore12
champion12
jour12
mto12
sries12
sport12
guerre12
programmes12
federer12
direct12
aussi12
belgique12
info12
voir12
tour11
vendredi11
cest11
fait11
avait11
toutes11
jai11
nature11
revoir11
festival11
tous10
cette10
dinvestigation10
films10
places10
aprs10
wallon10
concert10
ses10
cap10
gratuitdescriptionretrouvez10
je10
premire10
quel10
journaux9
libert9
aert9
pays9
roubaix9
gaz9
bruxelles9
sous9
heures19
van9
cri9
ont9
point9
vu9
t9
vido9
week-end9
selon9
verstappen9
unetypetvlogolightsvghttpswwwstaticrtbfbenewscommonoaossvglogotypelightlaunesvgpnghttpswwwstaticrtbfbenewscommonoaospnglogotypelightlaunepngdarksvghttpswwwstaticrtbfbenewscommonoaossvglogotypedarklaunesvgpnghttpswwwstaticrtbfbenewscommonoaospnglogotypedarklaunepnglogoauviov3lightsvghttpswwwstaticrtbfbenewscommonauviosvglogotypedarklaunesvgpnghttpswwwstaticrtbfbenewscommonauviopnglogotypedarklaunepngdarksvghttpswwwstaticrtbfbenewscommonauviosvglogotypedarklaunesvgpnghttpswwwstaticrtbfbenewscommonauviopnglogotypedarklaunepngsharemaradionullstatisticsgemiussctnullsela9
choses8
ralit8
cours8
cinma8
question8
linfo8
u00268
dtre8
face8
trs8
gouvernement8
vidos8
sans8
succs8
cinq8
site8
18
paris-match8
lige8
excellence8
people8
historique8
animaux8
docus8
seotitledocumentaires8
campagne8
28
thtre8
enfants8
namur8
nobel8
jouer7
programme7
bienveillance7
film7
school7
international7
lessence7
37
rentre7
pre7
ballet7
grand7
samedi7
mosa7
lactualit7
classes7
mir7
minle7
ministre7
comment7
jamie7
police7
contre7
cet7
tait7
47
mieux7
jeune7
quil7
coulisses7
libre7
srie7
tribulations7
ascension7
femme7
mre6
nouvelle6
dimanche6
milliard6
dollars6
dbloqus6
nadal6
adieux6
national6
runion6
rafael6
forest6
dernire6
devenir6
histoire6
quelle6
grise6
arm6
minla6
besoin6
web6
grce6
alors6
derniers6
reportage6
concours6
visage6
bord6
nouveau6
lui6
cts6
est-elle6
franaise6
fille6
nos6
lgende6
nord6
pro6
toujours6
entres6
quotidienne6
suivez6
empcher6
peut-il6
leclerc6
japon6
f16
56
actrice6
trois6
autres6
depuis6
reportages6
jeux5
patrick5
long5
littrature5
jardin5
fort5
ukrainienne5
cap485
dotationhier5
mettet5
lhumour5
ministres5
na5
tlviss5
coupe5
accord5
dx27une5
magellan5
voulez5
rsolument5
lambassade5
propose5
du0026039info5
lart5
65
dutroux5
dj5
hollywood5
tvtypetvlogolightsvghttpswwwstaticrtbfbenewscommonoaossvglogotypelighttipiksvgpnghttpswwwstaticrtbfbenewscommonoaospnglogotypelighttipikpngdarksvghttpswwwstaticrtbfbenewscommonoaossvglogotypedarktipiksvgpnghttpswwwstaticrtbfbenewscommonoaospnglogotypedarktipikpnglogoauviov3lightsvghttpswwwstaticrtbfbenewscommonauviosvglogotypedarktipiksvgpnghttpswwwstaticrtbfbenewscommonauviopnglogotypedarktipikpngdarksvghttpswwwstaticrtbfbenewscommonauviosvglogotypedarktipiksvgpnghttpswwwstaticrtbfbenewscommonauviopnglogotypedarktipikpngsharemaradionullstatisticsgemiussctnullsetipik5
iranien5
ancestorsid31labeldocumentairesdescriptionvoir5
chiffres5
lance5
couteau5
arrt5
75
dinfos5
euthanasie5
victime5
km25
85
prs5
truss5
liz5
crime5
colmar5
descriptiondcouvrez5
millions5
dizaines5
wallonie-bruxelles5
fdration5
seotitleinfo5
grands5
juliette5
saison5
mort5
elle5
quand5
chaque5
roger5
notre5
mons5
paris-tours5
semaine5
lors5
minutes15
lhomme4
prix4
football4
comme4
reste4
troistypetvlogolightsvghttpswwwstaticrtbfbenewscommonoaossvglogotypelightlatroissvgpnghttpswwwstaticrtbfbenewscommonoaospnglogotypelightlatroispngdarksvghttpswwwstaticrtbfbenewscommonoaossvglogotypedarklatroissvgpnghttpswwwstaticrtbfbenewscommonoaospnglogotypedarklatroispnglogoauviov3lightsvghttpswwwstaticrtbfbenewscommonauviosvglogotypedarklatroissvgpnghttpswwwstaticrtbfbenewscommonauviopnglogotypedarklatroispngdarksvghttpswwwstaticrtbfbenewscommonauviosvglogotypedarklatroissvgpnghttpswwwstaticrtbfbenewscommonauviopnglogotypedarklatroispngsharemaradionullstatisticsgemiussctnullsela4
suicide4
sept4
princesse4
choix4
professionnelle4
trop4
tenter4
culture4
rvrence4
retrouve4
94
moins4
tard4
vraie4
bout4
quoi4
dautres4
aubry4
personnes4
104
commissaire4
elizabeth4
tlfilms4
ii4
rfrence4
dominique4
nom4
fils4
lundi4
paul4
reyers4
ps4
mission4
musiquedescriptionvoir4
sest4
mettant4
personnalit4
style4
minvos4
musical4
sciencessant4
chute4
jours4
nouvelles4
mme4
portrait4
rendez-vous4
bob4
dylan4
dotationtitlevos4
magnette4
chez4
homme4
bton4
bots4
enfant4
114
budget4
laisse4
nombreuses4
commence4
juin4
sociaux4
traitant4
indices4
spectacles4
laurent4
magenta4
botanique4
divertissement4
vos4
tipik4
tlvis4
offre4
symbole4
passer4
internationale4
124
faut-il4
remontent4
psychique4
font4
souffrance4
attentats4
numro4
volodymyr4
contre-offensive4
librs4
territoires4
134
plainte4
renvoie4
ds4
144
radios4
primaire4
hommes4
2e4
1re4
annie4
tendue4
154
lente4
lcole4
affective4
sexuelle4
delphine4
prparait4
revacciner4
euros4
libr4
rle4
voyage4
top4
lombardie4
dernier4
pay4
footballeur4
devient4
edinson4
cavani4
eu4
minvoir4
gril4
passe4
journes4
evenepoel4
particulier4
stocks4
pourquoi4
incroyable4
acomptes4
explosent4
plutt4
minles4
remplis4
saint-trond4
cre4
retour4
formule4
petit4
35e4
grande4
k4
architecture4
puis4
we4
enfantins4
airs4
zeniter4
namadamu4
paix4
rgion4
trust4
capte4
raconter4
parle4
ukraineil4
clavier4
participera4
comdie4
joan4
match4
condamn4
disparition4
164
tanja4
prdateur4
groen4
en19934
cole4
standard3
charleroi3
confinement3
ils3
petite3
manzul3
moment3
malik3
intgralit3
mbenza3
173
onze3
belges3
victoire3
seotitlesries3
dixime3
websries3
ville3
rve3
votre3
sais3
virtuelle3
drle3
sujets3
lx27nergie3
bruyne3
hazard3
magazine3
journaliste3
prsent3
doit3
forbes3
183
dcs3
trot3
193
classequotcyclismehier3
dit3
oui3
quota3
ici3
revenir3
dois3
donnent3
rsiste3
armes3
appartient3
forg3
procdures3
minutes123
familles3
culturels3
informe3
tre3
19h303
attaque3
letat3
leur3
lune3
heures23
203
ronsard3
minutes23
213
peut-tre3
223
policiers3
annes3
tienne3
laisser3
lon3
couvrir3
franois3
david3
talk3
nseotitlelifestyle3
ancestorsid1labelinfodescriptionvoir3
niouzz3
pavs3
divorce3
passant3
ardennes3
ligue3
lifestyle3
lies3
journe3
mouvement3
authentique3
ton3
donner3
diffrent3
regard3
apportent3
elles3
destines3
dactualit3
metoo3
core3
lactu3
sent3
ophlie3
minute3
silence3
croisez3
meurtrier3
organise3
influence3
vrit3
besau3
disiez3
incomprise3
responsables3
saadaoui3
pilier3
tonnes3
233
fontana3
julien3
moiti3
sessions3
227e3
russe3
dclarait3
passes3
invite3
avoir3
grenades3
sortaient3
granel3
baptmes3
rcompense3
rveil3
populisme3
remportez3
quels3
bientt3
avons3
hasard3
extraordinaire3
explique3
situation3
pourrez3
semparent3
royal3
images3
parc3
marius3
lhiver3
parce3
permet3
playlist3
083
limit3
sky3
business3
do3
puissant3
buckingham3
resurgit3
astrid3
dalice3
contenu3
reprsentations3
retransmettre3
devrait3
patrice3
seriez-vous3
mariage3
alinejad3
moindre3
sandra3
limiter3
zidani3
vlo3
combat3
fait-elle3
masih3
marque3
rpond3
franais3
lukraine3
rseaux3
recours3
psychologue3
jeunes3
remontada3
bara3
entre3
me3
classeimagealtwout3
sens3
prt3
larme3
sommes-nous3
arrter3
veux3
final3
carrire3
classeimageurlxshttpsdsstaticrtbfbearticleimage180x100b3026d0975bec8affe658ceb2b620b1b74ajpgshttpsdsstaticrtbfbearticleimage370x208b3026d0975bec8affe658ceb2b620b1b74ajpgmhttpsdsstaticrtbfbearticleimage770x433b3026d0975bec8affe658ceb2b620b1b74ajpglhttpsdsstaticrtbfbearticleimage1248x702b3026d0975bec8affe658ceb2b620b1b74ajpgxlhttpsdsstaticrtbfbearticleimage1920x1080b3026d0975bec8affe658ceb2b620b1b74ajpgsummaryphilippe3
garance3
anne3
parler3
gala3
243
terres3
afrique3
loccasion3
monument3
lheure3
tir3
anxit3
sera3
viennent3
rver3
professionnelles3
victoires3
coureur3
peloton3
arditi3
offrent3
nergtique3
newbclap3
tentative3
hauts3
prne3
nerlandais3
russi3
officialiser3
-m-3
licence3
savoir3
ambition3
fournisseur3
bolcho3
benjamine3
cadeaux3
cloedt3
fin3
vitesse3
pierre3
moyen3
anniversaire3
fleuron3
moto3
vinci3
etats-unis3
gardien3
exceptionnelle3
court3
253
concrtes3
mesures3
bordure3
privilge3
dtaille3
dy3
infractions3
constate3
plusieurspublishedfrom2022-10-07t1712470200publicationdate2022-10-07t1712470200majorupdatedat2022-10-07t1712470200readingduration13

Who hosts Rtbf.be?

Rtbf.be Hosting Provider Information

Hosted IP Address:151.101.1.63
Hosted Hostname:151.101.1.63
Service Provider:Consortium GARR
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:Not Applicable

Is "Consortium GARR" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
18.0325%
GOOGLE
13.6423%
AS-26496-GO-DADDY-COM-LLC
3.1907%
NAMECHEAP-NET
3.0003%
AMAZON-AES
2.2030%
UNIFIEDLAYER-AS-1
1.9457%
GoDaddy.com, LLC
1.8580%
AMAZON-02
1.7036%
Fara Negar Pardaz Khuzestan
1.6187%
CONFLUENCE-NETWORK-INC
1.4064%
Consortium GARR
0.1115%

Rtbf.be Domain Nameserver Information

HostIP AddressCountry
ns2.rtbf.be 91.183.173.130Belgium Belgium
ns1.rtbf.be 193.191.130.158Belgium Belgium

Common Spelling Mistakes for Rtbf.be

etbf.bedtbf.beftbf.begtbf.be
ttbf.berrbf.berfbf.bergbf.be
rhbf.berybf.bertvf.bertff.be
rtgf.berthf.bertnf.bertbc.be
rtbd.bertbe.bertbr.bertbt.be
rtbg.bertbb.bertbv.bertbf.ve
rtbf.fertbf.gertbf.hertbf.ne
rtbf.bwrtbf.bsrtbf.bdrtbf.bf
rtbf.br   

Websites with Similar Names to Rtbf.be

Rtbf.be
RTBF le site de la Radio Télévision Belge Francophone
Rtbf.cloud
rtbf.cloud - Registered at Namecheap.com
Rtbf.fyi
rtbf.fyi - Registered at Namecheap.com
Rtbf.host
rtbf.host - Registered at Namecheap.com
Rtbf.onl
rtbf.onl
Rtbf.online
rtbf.online - Registered at Namecheap.com
Rtbf.wiki
rtbf.wiki - Registered at Namecheap.com