Saladaeletrica.com.br Favicon Saladaeletrica.com.br

Saladaeletrica.com.br Website Thumbnail
Checking...
Sala da Elétrica - Aulas sobre eletricidade na teoria e na prática
Low trust score
 | 
Add a review Change category Claim this site
Alcance os melhores resultados na carreira de eletricista com nossos cursos de elétrica e portal de conteúdo sobre eletricidade na teoria e na prática. Confira!


Domain summary

Domain label
saladaeletrica
Domain extension
com.br
Domain registered:
2011-09-30
Domain updated:
2020-09-30
Domain expires:
2021-09-30
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is saladaeletrica.com.br ranked relative to other sites:

Percentage of visits to saladaeletrica.com.br from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Saladaeletrica.com.br registered?
A: Saladaeletrica.com.br was registered 9 years, 1 month, 1 day, 13 hours, 9 minutes, 13 seconds ago on Friday, September 30, 2011.
Q: When was the WHOIS for Saladaeletrica.com.br last updated?
A: The WHOIS entry was last updated 1 month, 1 day, 13 hours, 9 minutes, 13 seconds ago on Wednesday, September 30, 2020.
Q: What are Saladaeletrica.com.br's nameservers?
A: DNS for Saladaeletrica.com.br is provided by the following nameservers:
  • ns01.zertico.com
  • ns02.zertico.com
Q: Who is the registrar for the Saladaeletrica.com.br domain?
A: The domain has been registered at BR-NIC.
Q: What is the traffic rank for Saladaeletrica.com.br?
A: Saladaeletrica.com.br has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Saladaeletrica.com.br each day?
A: Saladaeletrica.com.br receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Saladaeletrica.com.br resolve to?
A: Saladaeletrica.com.br resolves to the IPv4 address 45.77.111.213.
Q: In what country are Saladaeletrica.com.br servers located in?
A: Saladaeletrica.com.br has servers located in the United States.
Q: What webserver software does Saladaeletrica.com.br use?
A: Saladaeletrica.com.br is powered by Nginx webserver.
Q: Who hosts Saladaeletrica.com.br?
A: Saladaeletrica.com.br is hosted by Choopa, LLC in New Jersey, Hillsborough, United States, 08844.
Q: How much is Saladaeletrica.com.br worth?
A: Saladaeletrica.com.br has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Saladaeletrica.com.br?

Saladaeletrica.com.br Hosting Provider Information

Hosted IP Address:45.77.111.213
Hosted Hostname:45.77.111.213.vultr.com
Service Provider:Choopa, LLC
Hosted Country:United StatesUS
Location Latitude:40.4856
Location Longitude:-74.6265
Webserver Software:nginx

Is "Choopa, LLC" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Saladaeletrica.com.br

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Sat, 03 Oct 2020 19:43:59 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Keep-Alive: timeout=5
Vary: Accept-Encoding
Link:; rel=shortlink
Content-Encoding: gzip

Saladaeletrica.com.br Domain Nameserver Information

HostIP AddressCountry
ns01.zertico.com 184.173.181.142United States United States
ns02.zertico.com 184.173.181.150United States United States


Need to find out who hosts Saladaeletrica.com.br?


Domain Registration (WhoIs) information for Saladaeletrica.com.br

 % Copyright (c) Nic.br
% The use of the data below is only permitted as described in
% full by the terms of use at https://registro.br/termo/en.html ,
% being prohibited its distribution, commercialization or
% reproduction, in particular, to use it for advertising or
% any similar purpose.
% 2020-06-15T01:00:07-03:00

domain: saladaeletrica.com.br
owner: Everton Moraes
ownerid: 325.281.728-42
country: BR
owner-c: EPPMO
admin-c: EPPMO
tech-c: EPPMO
billing-c: EPPMO
nserver: ns01.zertico.com
nsstat: 20200612 AA
nslastaa: 20200612
nserver: ns02.zertico.com
nsstat: 20200612 AA
nslastaa: 20200612
saci: yes
created: 20110930 #8893551
changed: 20191001
expires: 20200930
status: published

nic-hdl-br: EPPMO
person: Everton Pacheco Pereira de Moraes
e-mail: Login to show email
BR
created: 20110930
changed: 20200226

% Security and mail abuse issues should also be addressed to
% cert.br, http://www.cert.br/ , respectivelly to Login to show email
and Login to show email
whois.registro.br accepts only direct match queries. Types
% of queries are: domain (.br), registrant (tax ID), ticket,
% provider, contact handle (ID), CIDR block, IP and ASN.

Saladaeletrica.com.br Free SEO Report

Website Inpage Analysis for Saladaeletrica.com.br

H1 Headings

1 :
  1. Sala da Elétrica

H2 Headings

3 :
  1. Nós vamos te guiar, na teoria e na prática!
  2. O segredo para você alcançar os resultados que sempre sonhou é seguir os passos de quem já conseguiu alcançar esses resultados!
  3. Nossos últimos artigos

H3 Headings

9 :
  1. Curso Aterramentos Elétricos na Prática
  2. Portal Eletricista de Sucesso
  3. Curso Método LIDE - Leitura e Interpretação de Diagramas Elétricos
  4. Curso Eletricista Autônomo Express
  5. Curso CADe SIMU Completo
  6. Curso Instalações Elétricas na Prática
  7. Curso Máquinas e Comandos Elétricos
  8. Ver Todos os Cursos
  9. Essa história pode ser a sua!

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

19 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-26303282-10

Links - Internal

44:
  1. https://www.saladaeletrica.com.br
    https://www.saladaeletrica.com.br
  2. Saladaeletrica Página Inicial
    https://www.saladaeletrica.com.br/
  3. Saladaeletrica Sobre
    https://www.saladaeletrica.com.br/nossa-historia/
  4. Saladaeletrica Blog
    https://www.saladaeletrica.com.br/blog/
  5. Saladaeletrica Materiais Educativos
    https://www.saladaeletrica.com.br/saladaeletrica/materiais-educativos/
  6. Saladaeletrica EBook
    https://www.saladaeletrica.com.br/materiais-educativos/e-book/
  7. Saladaeletrica Software
    https://www.saladaeletrica.com.br/materiais-educativos/software/
  8. Saladaeletrica Webinar
    https://www.saladaeletrica.com.br/materiais-educativos/webinar/
  9. Saladaeletrica Todos os materiais
    https://www.saladaeletrica.com.br/saladaeletrica/materiais-educativo
  10. Saladaeletrica ÁREA DO ALUNO
    https://ead.saladaeletrica.com.br
  11. Saladaeletrica Cursos
    https://www.saladaeletrica.com.br/cursos/
  12. Saladaeletrica Curso Máquinas e Comandos Elétricos
    https://www.saladaeletrica.com.br/cursos/maquinas-e-comandos-eletricos/
  13. Saladaeletrica CLP – Controladores Lógicos Programáveis Online
    https://www.saladaeletrica.com.br/cursos/clp/
  14. Saladaeletrica Curso Instalações Elétricas na Prática
    https://www.saladaeletrica.com.br/cursos/curso-instalacoes-eletricas-na-pratica/
  15. Saladaeletrica Ver Todos os Cursos
    https://www.saladaeletrica.com.br/cursos/
  16. Saladaeletrica Curso online
    https://www.saladaeletrica.com.br/cursos_categoria/curso-online/
  17. https://www.saladaeletrica.com.br/cursos/curso-aterramentos-eletricos-na-pratica/
    https://www.saladaeletrica.com.br/cursos/curso-aterramentos-eletricos-na-pratica/
  18. https://www.saladaeletrica.com.br/cursos/portal-eletricista-de-sucesso/
    https://www.saladaeletrica.com.br/cursos/portal-eletricista-de-sucesso/
  19. https://www.saladaeletrica.com.br/cursos/metodo-lide/
    https://www.saladaeletrica.com.br/cursos/metodo-lide/
  20. https://www.saladaeletrica.com.br/cursos/etetricista-autonomo-express/
    https://www.saladaeletrica.com.br/cursos/etetricista-autonomo-express/
  21. Saladaeletrica Curso gratuito
    https://www.saladaeletrica.com.br/cursos_categoria/curso-gratuito/
  22. https://www.saladaeletrica.com.br/cursos/cade-simu/
    https://www.saladaeletrica.com.br/cursos/cade-simu/
  23. https://www.saladaeletrica.com.br/cursos/curso-instalacoes-eletricas-na-pratica/
    https://www.saladaeletrica.com.br/cursos/curso-instalacoes-eletricas-na-pratica/
  24. https://www.saladaeletrica.com.br/cursos/maquinas-e-comandos-eletricos/
    https://www.saladaeletrica.com.br/cursos/maquinas-e-comandos-eletricos/
  25. Saladaeletrica Curso online
    https://www.saladaeletrica.com.br/cursos/
  26. https://www.saladaeletrica.com.br/cursos/
    https://www.saladaeletrica.com.br/cursos/
  27. Saladaeletrica Comandos
    https://www.saladaeletrica.com.br/eletrica/coel/
  28. Saladaeletrica Cursos de Elétrica
    https://www.saladaeletrica.com.br/cursos-de-eletrica/
  29. Saladaeletrica Essa história pode ser a sua!
    https://www.saladaeletrica.com.br/case-de-sucess-jose/
  30. Saladaeletrica LER ARTIGO
    https://www.saladaeletrica.com.br/case-de-sucess-jose/
  31. Saladaeletrica Curso de Eletricidade Geral Completo
    https://www.saladaeletrica.com.br/cursos/eletricidade-geral/
  32. Saladaeletrica As 6 Cores de Botões e Sinaleiros
    https://www.saladaeletrica.com.br/?post_type=materiais_educativos&p=28
  33. Saladaeletrica Como Ser um Eletricista Autônomo de Sucesso.
    https://www.saladaeletrica.com.br/ser-eletricista-autonomo/
  34. Saladaeletrica CLP: Tipos de Entradas e Saídas
    https://www.saladaeletrica.com.br/entradas-saidas-clp/
  35. Saladaeletrica Quais são os Componentes de Comandos Elétricos?
    https://www.saladaeletrica.com.br/componentes-comandos-eletricos/
  36. Saladaeletrica Contator ZUMBI! Você já ouviu falar dele?
    https://www.saladaeletrica.com.br/contator-com-ruido/
  37. Saladaeletrica Podcast – Leitura e interpretação de diagramas elétricos
    https://www.saladaeletrica.com.br/?p=16441
  38. Saladaeletrica Borne: 3 Motivos para usá-los em seu painel.
    https://www.saladaeletrica.com.br/borne-3-motivos-para-usar/
  39. Saladaeletrica Materiais educativos
    https://www.saladaeletrica.com.br/saladaeletrica/materiais-educativos/
  40. Saladaeletrica Área do aluno
    https://ead.saladaeletrica.com.br/
  41. Saladaeletrica Contato
    https://www.saladaeletrica.com.br/contato/
  42. Saladaeletrica Termos de Uso
    https://www.saladaeletrica.com.br/termo-de-uso/
  43. Saladaeletrica Política de Privacidade
    https://www.saladaeletrica.com.br/politica-de-privacidade/
  44. Saladaeletrica TERMO DE USO
    https://www.saladaeletrica.com.br/termo-de-uso/

Links - Internal (nofollow)

0:

Links - Outbound

5:
  1. https://www.facebook.com/SalaDaEletrica
    https://www.facebook.com/SalaDaEletrica
  2. https://www.instagram.com/saladaeletrica/
    https://www.instagram.com/saladaeletrica/
  3. https://www.youtube.com/channel/UCc39T86eiy5k_Hi3Al5nDEw
    https://www.youtube.com/channel/UCc39T86eiy5k_Hi3Al5nDEw
  4. https://www.linkedin.com/company/sala-da-el%C3%A9trica
    https://www.linkedin.com/company/sala-da-el%C3%A9trica
  5. https://www.agenciamestre.com/
    https://www.agenciamestre.com/

Links - Outbound (nofollow)

0:

Keyword Cloud for Saladaeletrica.com.br

aprendizadocomandosquesalveimg alterarimagem0contedosonlinecursovar alterarimagemalterarimageminstalaes eltricasrea dovar newlink documentcreateelementaemeducativosalterarimagem0remove newlinkappendchildsalveimgnewlinkcursosvar salveimg alterarimagem0todosdoecurso mquinaseltricada eltricamquinas esalveimgsobremateriaise comandosalterarimagem0parentnodeprependnewlink varcursona prticaalterarimagem0parentnodeprependnewlinkinstalaesalterarimagem0eletricistacurso mquinas ealterarimagem0 alterarimagem0removemquinasnewlink documentcreateelementa newlinksetattributehrefmquinas e comandosdocumentcreateelementaprticasalveimg alterarimagem0 alterarimagem0removeparaalunotodos oseltricoseltricasmateriais educativosonlinesala darea do alunoreasala da eltricaalterarimagem0parentnodeprependnewlink var salveimgnewlink documentcreateelementanossosalterarimagem0 alterarimagem0remove newlinkappendchildsalveimgsalavar newlinkblogosnewlinksetattributehrefnewlinkappendchildsalveimgalterarimagem0removeonaque vocvar salveimgvarcomandos eltricosdocumentcreateelementa newlinksetattributehrefvocdo alunodaseu

Longtail Keyword Density for Saladaeletrica.com.br

KeywordsOccurences
mquinas e comandos4
rea do aluno3
curso mquinas e3
sala da eltrica3
var newlink documentcreateelementa3
newlink documentcreateelementa newlinksetattributehref3
alterarimagem0parentnodeprependnewlink var salveimg3
var salveimg alterarimagem03
salveimg alterarimagem0 alterarimagem0remove3
alterarimagem0 alterarimagem0remove newlinkappendchildsalveimg3
e comandos4
mquinas e4
todos os4
materiais educativos3
var alterarimagem3
alterarimagem0 alterarimagem0remove3
salveimg alterarimagem03
var salveimg3
alterarimagem0parentnodeprependnewlink var3
documentcreateelementa newlinksetattributehref3
newlink documentcreateelementa3
var newlink3
da eltrica3
que voc3
sala da3
na prtica3
instalaes eltricas3
comandos eltricos3
curso mquinas3
do aluno3
rea do3
alterarimagem0remove newlinkappendchildsalveimg3
e23
var10
os10
eltrica8
na8
cursos8
voc7
comandos7
para7
do6
curso6
onlinecurso6
da6
nossos5
em5
o5
sobre5
rea4
mquinas4
todos4
que4
seu4
aluno4
eltricos4
blog4
online4
prtica4
materiais4
alterarimagem03
newlink3
salveimg3
alterarimagem0remove3
alterarimagem0parentnodeprependnewlink3
newlinksetattributehref3
documentcreateelementa3
eltricas3
alterarimagem3
educativos3
contedos3
instalaes3
aprendizado3
eletricista3
sala3
newlinkappendchildsalveimg3

Saladaeletrica.com.br Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Websites with Similar Names

Salad-days.biz
Index of /
Salad-express.com
Tootsie's Catering • Salad Express at the Terminal
Salad-farm.jp
岩手八幡平「食と癒しの空間」サラダファーム/公式ホームページ
Salad-in-a-jar.com
Title Salad in a Jar | and other secrets of a home economist
Salad-on-the-go.com
Site Unavailable
Salad-or.com
404 - Page Not Found
Salad-people.de
Host Europe GmbH – salad-people.de

Recently Updated Websites

Schartau.com 2 seconds ago.Montage4schools.info 2 seconds ago.Giascloset.com 2 seconds ago.Ctandl.com 4 seconds ago.Bebrignais.com 5 seconds ago.Asiaiota.org 5 seconds ago.Sro-16.ru 5 seconds ago.Marceloholanda.com 6 seconds ago.Eduardopenna.com.br 6 seconds ago.Andtheniwaslike.co 6 seconds ago.I-teh.com 7 seconds ago.Fathersrightsmovement.us 9 seconds ago.Meigui520.com 9 seconds ago.Guitarsymposium.de 11 seconds ago.Craig-west.co.uk 11 seconds ago.Downy.com 11 seconds ago.Teamtrommeln.com 13 seconds ago.Moradadaserra.net 13 seconds ago.Nominateforindexaward.dk 13 seconds ago.1blood.org 13 seconds ago.Convergedip.com 14 seconds ago.Lwv-eastalabama.org 14 seconds ago.Billdit.net 15 seconds ago.Pemasarandigital.com 15 seconds ago.Tangoclub.info 15 seconds ago.Openbluenetworks.com 15 seconds ago.Wpislife.com 16 seconds ago.Dgobert.com 16 seconds ago.Tt200.com 17 seconds ago.Familienzirkel.com 17 seconds ago.