salony.co

Safety: High trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Forsale Lander



Domain summary

Last updated
2021-06-10
Domain label
salony
Domain extension
co
Domain registered:
2020-03-00
Domain updated:
2021-09-00
Domain expires:
2021-03-00
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
High trust score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Salony.co registered?
A: Salony.co was registered 1 year, 5 months, 1 day, 6 hours, 41 minutes, 27 seconds ago on Saturday, February 29, 2020.
Q: When was the WHOIS for Salony.co last updated?
A: The WHOIS entry was last updated 1 month, 17 hours, 18 minutes, 32 seconds ago on Tuesday, August 31, 2021.
Q: What are Salony.co's nameservers?
A: DNS for Salony.co is provided by the following nameservers:
  • ns3.afternic.com
  • ns4.afternic.com
Q: Who is the registrar for the Salony.co domain?
A: The domain has been registered at .CO Internet, S.A.S..
Q: What is the traffic rank for Salony.co?
A: Salony.co has a High trust score, and a Statvoo Rank of I.
Q: How many people visit Salony.co each day?
A: Salony.co receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Salony.co resolve to?
A: Salony.co resolves to the IPv4 address 13.248.216.40.
Q: In what country are Salony.co servers located in?
A: Salony.co has servers located in the United States.
Q: What webserver software does Salony.co use?
A: Salony.co is powered by webserver.
Q: Who hosts Salony.co?
A: Salony.co is hosted by AMAZON-02 in United States.
Q: How much is Salony.co worth?
A: Salony.co has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Salony.co Reviews

We have 1 review(s) for Salony.co

Add your review
Verified United Kingdom

 (5 years ago)
 

"Nice work! My website is designed by salony.co. I feel very happy with it"


Nice work! My website is designed by salony.co. I feel very happy with it

Salony.co Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Salony.co

H1 Headings

1 :
  1. salony.co

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

2 :
  1. Need a price instantly? Contact us now.
  2. Need a price instantly? Contact us now.

H5 Headings

1 :
  1. This domain is available for sale!

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

2 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Salony.co

partiesnoteyourprivacy shieldwe usemay include firstcan accessdiscloseonlydomaindo notu003cau003eprivacytimewishlesspracticesorderthembutshare yoursingleservices applications toolscomplianceyou have anyconsentenforcementresolutionour privacy policyinstantly contactyou visitreceivedtrack signaleuour servicesclicklocalbrowsermoreyour browsernamebrandswitzerlandcookies webhelptheydifferentrelatedsubjectquestionsplacedyou canacrossplease contactofficeprovidedsettingsweb beaconsandoreximportantloggedcanmost importantadvertisinghasmay includemaintainthirdpartyhelp usframeworkwithindeviceincextentmightmeansour sites servicesservice providersyour deviceallows uspurchasedstoredomainsexperiencetools or messaginginteract with ouryour businessmarketingservices werequestsalso collectcertainimprove ourusedthird partybrowsersapplicationsapplicableusingreceivealldescribedlaw enforcementnecessarysettingauthorized serviceidentifyoperatingdomain nameususe our servicesyour informationprivacy shield frameworkfirst or thirdpartylinksinformation weotherour privacyourdata collectedeachone of ourwe collectinstantlytrackcustomersmessagingallowus to providesitescookieinvestmentour siteagesites services applicationspolicyinternetwhich wegoodsvaremailpermittedif youyou can makeproviderservices applicationslawpurposesgivecookiesimprovebetterpartyperformance of ouruselagree to ouryour personal informationinterestsyou use ourdo not trackwebthese technologiespagesservices you haveonlinebothuserip addressinvestment you canour domaincontact usthanfeaturesgatheryou agreesingle most importantprotectfindcontentoftendata protectionafternicage of 18phonewe mayoperating companyour practicessingle mostlegaldeletedelete youroptionsdeliverthirdproductsyou usemediaserveplease noteprotectionifnotifybehalflikecustomerrequestedcookies web beaconssalegoods or servicesappropriatetransferredmakeprivacyllcbeenyoutechnologiesdatau003cstrongu003einvestment youoverthirdparty cookiesprovide youoneinternet browserwe utilizecompany llcgodaddy operating companycountrythroughsecuritydpoauthorized service providersyour personalpersonalneededrelevantdodirectlyrightslegitimatemost important investmenteffectivenessinteractreasonweyou havefunctionsregardingour websitesscriptscan makeindividualssignalvisit ouraddresspreferencesavailablefirstmustaccounthavenotbeaconschatscriptcallpreventfoundpublicfunctionless thanparty servicetoolsduringcurrentlymake for yourcollect dataincludingscripts placedhave anyfileshereimportant investmentservicepurposedomain expertsauthorizedsellyou utilizeplaced in orderthirdparty cookies webgodaddy operatingclickingsecureprocessrequiredsoso that wethesemethodstypevisitorssiteour sitessamegetwe haveimportant investment youincludeservices youinstantly contact usshieldsmallthosemay contactinformationprovidevisitprice instantly contacttransferyour internet browseressentialunderstandsupportmay alsocollect informationexperts0personal informationrequestwebsiteyour internetour authorized serviceyou mayintoservicesour websiteunderany informationcouldanonymousallowingyour accountshield frameworkallow usrequireanalyzedatabelowgovernmentpurchasegive usadditionalcomplaintsfreeprovidersprinciplesour domain expertsitsmaypagecontact ourshareupdatepixelscan be foundcmostany personalmobileoutcollectalsoprice instantlygodaddyinclude firstnot track signaltruebusinessuse ourbasedcompanyanynot tracknot sellsuchdoperating company llccompletevariouswebsitesanalyticsbelievesectioncontactinformation we collectaccessutilizeapplications toolssites servicesallow you1products and servicesany timepleaseotherwisewhichbeacons and similarhave beencollectedsomeallowsthird partiesprivacy policyservices includingtechnologies mayadditional informationour authorizedcontactsvalueperformancecollectionwe canipagreesimilarfunctionalitypricesimilar technologies

Longtail Keyword Density for Salony.co

KeywordsOccurences
your personal information14
cookies web beacons7
interact with our7
privacy shield framework5
do not track5
beacons and similar5
our sites services4
services you have4
sites services applications4
our authorized service3
tools or messaging3
services applications tools3
you have any3
authorized service providers3
may include first3
first or third-party3
third-party cookies web3
our privacy policy3
placed in order3
age of 183
not track signal3
your internet browser3
single most important3
goods or services3
agree to our3
important investment you3
investment you can3
you can make3
make for your3
price instantly contact3
instantly contact us3
one of our3
our domain experts3
you use our3
most important investment3
use our services3
products and services3
godaddy operating company3
operating company llc3
so that we3
information we collect3
us to provide3
performance of our3
can be found3
personal information28
our services19
your personal16
if you12
do not12
you have12
contact us11
privacy shield11
privacy policy9
these technologies9
we collect9
cookies web9
you may8
your browser8
you can8
you visit7
may also7
web beacons7
service providers7
third party7
we use7
you use6
not track6
services you6
our site6
our website6
third parties6
we may6
our sites6
we have6
allow us5
shield framework5
data protection5
information we5
use our5
services we4
contact our4
your device4
help us4
our websites4
allows us4
services applications4
your account4
share your4
law enforcement4
our practices4
our privacy4
give us4
data collected4
similar technologies4
sites services4
you utilize3
our authorized3
please contact3
your internet3
may contact3
party service3
collect information3
have any3
scripts placed3
any information3
third-party cookies3
delete your3
include first3
track signal3
applications tools3
may include3
technologies may3
authorized service3
single most3
services including3
allow you3
domain name3
important investment3
investment you3
can make3
your business3
price instantly3
instantly contact3
less than3
our domain3
domain experts3
you agree3
not sell3
improve our3
collect data3
can access3
godaddy operating3
any personal3
provide you3
have been3
which we3
your information3
please note3
visit our3
we utilize3
ip address3
operating company3
most important3
additional information3
also collect3
we can3
any time3
company llc3
internet browser3
you114
our110
your82
we73
information73
services52
us47
use37
may37
cookies33
any33
personal33
data30
privacy29
not27
have24
these22
if21
technologies21
collect20
contact19
browser19
can19
website19
domain18
including16
other16
also15
service15
provide15
do15
web14
tools14
necessary14
third14
device14
only13
such13
visit13
settings13
please12
shield12
support11
here11
price11
policy11
used11
all11
advertising11
help11
site10
which10
allow10
they9
make9
applications9
business9
account9
so9
party9
legal8
internet8
phone8
similar8
time8
llc8
beacons8
more8
interact8
track8
sites8
utilize8
websites8
purchase8
parties8
purposes7
update7
allows7
under7
performance7
providers7
placed7
improve7
products7
experience7
access6
preferences6
collected6
email6
goods6
rights6
than6
provided6
most6
visitors6
law6
office6
protection6
name6
security6
order6
third-party6
essential6
might5
delete5
identify5
questions5
deliver5
additional5
company5
purchased5
practices5
framework5
eu5
give5
afternic5
enforcement5
has5
free5
below5
believe5
relevant5
share5
content5
some5
request5
local5
been5
customer5
within5
first5
customers5
brand5
those5
complaints5
required5
received4
consent4
prevent4
include4
through4
behalf4
like4
store4
receive4
cookie4
using4
permitted4
marketing4
during4
analyze4
page4
legitimate4
user4
address4
its4
but4
different4
chat4
messaging4
small4
pixels4
process4
get4
gather4
one4
out4
04
found4
l4
value4
browsers4
methods4
available4
requested4
reason4
operating4
section4
complete4
mobile4
directly4
described4
ex4
setting3
applicable3
scripts3
country3
c3
d3
transferred3
options3
across3
contacts3
script3
often3
functions3
extent3
protect3
signal3
public3
means3
currently3
age3
requests3
13
appropriate3
notify3
disclose3
each3
principles3
switzerland3
authorized3
inc3
certain3
maintain3
otherwise3
interests3
analytics3
find3
online3
must3
sale3
u003cau003eprivacy3
over3
based3
function3
var3
click3
media3
pages3
serve3
functionality3
transfer3
both3
understand3
anonymous3
effectiveness3
logged3
sell3
agree3
clicking3
experts3
less3
instantly3
investment3
important3
single3
secure3
domains3
regarding3
better3
provider3
allowing3
subject3
related3
them3
into3
individuals3
andor3
compliance3
purpose3
datau003cstrongu003e3
note3
wish3
ip3
call3
features3
resolution3
files3
various3
type3
links3
collection3
require3
government3
dpo3
could3
same3
needed3
godaddy3
true3

Who hosts Salony.co?

Salony.co Hosting Provider Information

Hosted IP Address:13.248.216.40
Hosted Hostname:afdda383cf24ec8c3.awsglobalaccelerator.com
Service Provider:AMAZON-02
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:Not Applicable

Is "AMAZON-02" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.2088%
Unknown
5.0138%
AS-26496-GO-DADDY-COM-LLC
4.3256%
NAMECHEAP-NET
3.6268%
AMAZON-AES
2.7254%
GoDaddy.com, LLC
2.4825%
UNIFIEDLAYER-AS-1
2.3319%
Fara Negar Pardaz Khuzestan
1.9947%
CONFLUENCE-NETWORK-INC
1.7092%
1&1 Internet AG
1.6708%
AMAZON-02
0.6911%

HTTP Header Analysis for Salony.co

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Content-Type: text/html; charset=utf-8
Content-Security-Policy-Report-Only: default-src 'self' www.google.com www.gstatic.com img6.wsimg.com *.secureserver.net collect.tealiumiq.com *.akamaihd.net c.go-mpulse.net *.akstat.io www.google-analytics.com www.googletagmanager.com stats.g.doubleclick.net googletagmanager.com *.godaddy.com data:;font-src * data: blob:;style-src 'self' 'unsafe-inline' img6.wsimg.com www.gstatic.com;script-src * data: blob: 'unsafe-inline' 'unsafe-eval';img-src * data: blob:;connect-src * data: blob:;frame-src * data: blob:;report-uri /forsale/api/csp-reports
X-DNS-Prefetch-Control: off
Expect-CT: max-age=0
X-Frame-Options: SAMEORIGIN
Strict-Transport-Security: max-age=15552000; includeSubDomains
X-Download-Options: noopen
X-Content-Type-Options: nosniff
X-Permitted-Cross-Domain-Policies: none
Referrer-Policy: no-referrer
X-XSS-Protection: 0
ETag: "17d2b-b38G7vXr6hsykTWTwItFq PT gM"
Content-Encoding: gzip
X-Akamai-Transformed: 9 - 0 pmb=mRUM,3
Date: Thu, 10 Jun 2021 20:34:10 GMT
Transfer-Encoding: chunked
Connection: Transfer-Encoding
Vary: Accept-Encoding
Server-Timing: cdn-cache; desc=MISS

Salony.co Domain Nameserver Information

HostIP AddressCountry
ns3.afternic.com 97.74.98.65
ns4.afternic.com 173.201.66.65


Need to find out who hosts Salony.co?


Domain Registration (WhoIs) information for Salony.co

 Domain Name: salony.co
Registry Domain ID: D60A08501E97247C4B0DF11135889CE17-NSR
Registrar WHOIS Server: whois.namesilo.com
Registrar URL: www.namesilo.com
Updated Date: 2021-06-09T21:25:56Z
Creation Date: 2020-07-03T09:53:53Z
Registry Expiry Date: 2021-07-03T09:53:53Z
Registrar: NameSilo, LLC
Registrar IANA ID: 1479
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4805240066
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: REDACTED FOR PRIVACY
Registrant Name: REDACTED FOR PRIVACY
Registrant Organization: See PrivacyGuardian.org
Registrant Street: REDACTED FOR PRIVACY
Registrant Street: REDACTED FOR PRIVACY
Registrant Street: REDACTED FOR PRIVACY
Registrant City: REDACTED FOR PRIVACY
Registrant State/Province: AZ
Registrant Postal Code: REDACTED FOR PRIVACY
Registrant Country: US
Registrant Phone: REDACTED FOR PRIVACY
Registrant Phone Ext: REDACTED FOR PRIVACY
Registrant Fax: REDACTED FOR PRIVACY
Registrant Fax Ext: REDACTED FOR PRIVACY
Registrant Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Admin ID: REDACTED FOR PRIVACY
Admin Name: REDACTED FOR PRIVACY
Admin Organization: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin City: REDACTED FOR PRIVACY
Admin State/Province: REDACTED FOR PRIVACY
Admin Postal Code: REDACTED FOR PRIVACY
Admin Country: REDACTED FOR PRIVACY
Admin Phone: REDACTED FOR PRIVACY
Admin Phone Ext: REDACTED FOR PRIVACY
Admin Fax: REDACTED FOR PRIVACY
Admin Fax Ext: REDACTED FOR PRIVACY
Admin Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Tech ID: REDACTED FOR PRIVACY
Tech Name: REDACTED FOR PRIVACY
Tech Organization: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech City: REDACTED FOR PRIVACY
Tech State/Province: REDACTED FOR PRIVACY
Tech Postal Code: REDACTED FOR PRIVACY
Tech Country: REDACTED FOR PRIVACY
Tech Phone: REDACTED FOR PRIVACY
Tech Phone Ext: REDACTED FOR PRIVACY
Tech Fax: REDACTED FOR PRIVACY
Tech Fax Ext: REDACTED FOR PRIVACY
Tech Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Name Server: ns3.afternic.com
Name Server: ns4.afternic.com
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2021-06-10T20:34:12Z

Websites with Similar Names

Salon-04.com
Loading...
Salon-08.com
Hair and Spray Tanning Salon West Seattle | Salon 08 | United States
Salon-121.com
SALON 121
Salon-13.com
红旗彩票app下载|官网
Salon-2-mariage.com
Félicitations ! Votre domaine a bien été créé chez OVH !

Recently Updated Websites

Fitandfreefitness.com (6 seconds ago.)Ses-online.com (8 seconds ago.)Lakeviewtrans.com (10 seconds ago.)Hoddows-gastwerk.de (12 seconds ago.)Upscaleadviser.com (12 seconds ago.)Iriny-tours.cz (12 seconds ago.)Silvergreybluestone.com (19 seconds ago.)Crossil.com (19 seconds ago.)Pickgrap.com (20 seconds ago.)Studio-original.com (25 seconds ago.)Couponcodespage.com (26 seconds ago.)Controlsanisur.com (28 seconds ago.)Edonline.com (28 seconds ago.)Alextveit.com (30 seconds ago.)Estudiocontabledsm.com (33 seconds ago.)Captain-alex.fr (35 seconds ago.)Pushing-boundaries.org (36 seconds ago.)Jornalcentral.com.br (39 seconds ago.)Gzcyled.com (41 seconds ago.)Masakapatakjadiharini.com (41 seconds ago.)Bigbrownmelons.com (43 seconds ago.)Hausie.com (43 seconds ago.)Kkoffee.shop (45 seconds ago.)Palio.net (47 seconds ago.)Bcd-innovation.com (47 seconds ago.)Arquitectacarlaarce.com (50 seconds ago.)Bjhagendasi.com (52 seconds ago.)Olympiabookfair.com (52 seconds ago.)Dungeoninquisitor.com (55 seconds ago.)Moneytextbot.com (58 seconds ago.)

Recently Searched Keywords

euro5 (1 second ago.)td-post-category display (1 second ago.)pogo pro (3 seconds ago.)steiermark (6 seconds ago.)lesben (9 seconds ago.)startcolorstr59000000endcolorstr00131313gradienttype1 (11 seconds ago.)saturday nov (15 seconds ago.)span font-size 15px (16 seconds ago.)solid rgba68 5 (18 seconds ago.)spade (19 seconds ago.)prediksi 4d toto macau jam 16.00 (20 seconds ago.)smallh5 smallh6 smallh1 (22 seconds ago.)few know (23 seconds ago.)plante container (25 seconds ago.)site para (26 seconds ago.)study less (26 seconds ago.)2021february 18 (28 seconds ago.)vs 0416 (30 seconds ago.)cookiedeclinebuttontext else (31 seconds ago.)settimeoutfunction module-content- miid (32 seconds ago.)success rates (33 seconds ago.)0196 | black red (33 seconds ago.)series x (34 seconds ago.)home (current) (35 seconds ago.)septic tank (36 seconds ago.)hyundai tucson (37 seconds ago.)self care (39 seconds ago.)step 038 (40 seconds ago.)sanibel (40 seconds ago.)rohbauarbeiten (40 seconds ago.)