Sanindia.net Website Analysis Summary

Sanindia.net  |  Home | Sanindia.Net
Low trust score  | 

Rank
329,789
Rating
G
Trust Score
Low Trust Score
Estimated worth
$28,080
Estimated daily income
$52
Estimated monthly income
$1,582
Backlinks
0

Sanindia.net has a Low Trust Score, and a Statvoo Rank of G.

Sanindia.net is hosted by Confluence Networks Inc in Maharashtra, Mumbai, India, 400072.
Sanindia.net has an IP Address of 103.21.58.60 and a hostname of bh-in-4.webhostbox.net.

The domain sanindia.net was registered 1 decade 6 years 6 days ago by , it was last modified 4 years 10 months 3 weeks ago and currently is set to expire 3 years 1 week 3 days ago.

It is the world's 329,789 most popular site among over 300 million websites.

Sanindia.net has a total of 0 backlinks.

Sanindia.net gets approximately 3,471 unique visitors a day and 18,680 pageviews per day.

Sanindia.net has an estimated worth of $28,080.
An average daily income of approximately $52, which is wroughly $1,582 per month.

Whois information for sanindia.net

Full Whois Lookup for Sanindia.net Whois Lookup

Domain Name: SANINDIA.NET
Registry Domain ID: 131587441_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.PublicDomainRegistry.com
Registrar URL: http://www.publicdomainregistry.com
Updated Date: 2015-07-25T06:44:51Z
Creation Date: 2004-10-02T10:05:12Z
Registry Expiry Date: 2017-10-02T10:05:12Z
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.2013775952
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.SANINDIA.NET
Name Server: NS2.SANINDIA.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-08-21T04:42:44Z

Who hosts Sanindia.net?

Sanindia.net Web Server Information

Hosted IP Address:103.21.58.60
Hosted Hostname:bh-in-4.webhostbox.net
Service Provider:Confluence Networks Inc
Hosted Country:IndiaIN
Location Latitude:19.0748
Location Longitude:72.8856
Webserver Software:Not Applicable

HTTP Header Analysis for Sanindia.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 04 Jun 2015 09:19:38 GMT
Server: Apache Phusion_Passenger/4.0.10 mod_bwlimited/1.4 mod_fcgid/2.3.9
X-Powered-By: PHP/5.3.28
X-Pingback: http://www.sanindia.net/xmlrpc.php
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Need to find out who hosts Sanindia.net?

Sanindia.net Free SEO Report

Website Inpage Analysis for Sanindia.net

H1 Headings:1
0
H2 Headings:1
0
H3 Headings:1
0
H4 Headings:1
0
H5 Headings:1
0
H6 Headings:1
0
Total IFRAMEs:0
Total Images:2
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Sanindia.net

sidebarwidth mathfloormainwidth headerwidthmathfloormainwidth1functionresizesmallheaderseasingeaseoutsinespanrightthisstopanimatewidthsidebarwidthopacity1 duration400 easingeaseoutsinevar sidebarwidth mathfloormainwidthspanrightthisstopanimatewidthsidebarwidthopacity1mainwidth jqueryspanleft spanrightthisstopanimatewidthsidebarwidthopacity1duration400var headerwidthmainwidthsidebarwidth mathfloormainwidth02 headerwidthmathfloormainwidth headerwidthspanrightthisstopanimatewidthsidebarwidthopacity1 duration400sidebarwidthvar sidebarwidthheaderwidth mainwidthifjqueryspanleftthiswidth 2 headerwidthjqueryspanleft spanrightthisstopanimatewidthsidebarwidthopacity1 duration400headerwidth mainwidth jqueryspanleftduration400 easingeaseoutsinevar mainwidthfunction varifjqueryspanleftthiswidthjqueryspanleft spanrightthisstopanimatewidthsidebarwidthopacity1ifjqueryspanleftthiswidth 2jqueryspanleftheaderwidthmainwidth jqueryspanleftfunction var headerwidth2 headerwidth mainwidthvar

Longtail Keyword Density for Sanindia.net

KeywordsOccurences
mainwidth jqueryspanleft spanrightthisstopanimatewidthsidebarwidthopacity14
jqueryspanleft spanrightthisstopanimatewidthsidebarwidthopacity1 duration4004
spanrightthisstopanimatewidthsidebarwidthopacity1 duration400 easingeaseoutsine4
headerwidth mainwidth jqueryspanleft4
2 headerwidth mainwidth4
var sidebarwidth mathfloormainwidth4
sidebarwidth mathfloormainwidth headerwidth4
ifjqueryspanleftthiswidth 2 headerwidth4
function var headerwidth3
mainwidth jqueryspanleft4
headerwidth mainwidth4
jqueryspanleft spanrightthisstopanimatewidthsidebarwidthopacity14
spanrightthisstopanimatewidthsidebarwidthopacity1 duration4004
duration400 easingeaseoutsine4
2 headerwidth4
ifjqueryspanleftthiswidth 24
var sidebarwidth4
function var4
sidebarwidth mathfloormainwidth4
mathfloormainwidth headerwidth4
var headerwidth3
var mainwidth3
var15
headerwidth11
mainwidth9
function8
07
sidebarwidth5
spanrightthisstopanimatewidthsidebarwidthopacity14
duration4004
easingeaseoutsine4
jqueryspanleft4
ifjqueryspanleftthiswidth4
14
mathfloormainwidth4
resizesmallheaders3

What are the nameservers for sanindia.net?

Sanindia.net Domain Nameserver Information

HostIP AddressCountry
UnknownUnknownUnknownUnknown