Domain summary

Last updated
2020-11-07
Domain label
santander
Domain extension
com.br
Global Traffic Rank
9,686
Statvoo Rating
B
Trust Score
High trust score
Estimated worth
$3,413,880
Estimated daily income
$3,161
Estimated monthly income
$96,147

Frequently Asked Questions (FAQ)

Q: When was Santander.com.br registered?
A: Santander.com.br was registered 2021 years, 11 months, 4 weeks, 6 hours, 5 minutes, 11 seconds ago on Monday, November 30, -0001.
Q: When was the WHOIS for Santander.com.br last updated?
A: The WHOIS entry was last updated 2021 years, 11 months, 4 weeks, 6 hours, 5 minutes, 11 seconds ago on Monday, November 30, -0001.
Q: What are Santander.com.br's nameservers?
A: DNS for Santander.com.br is provided by the following nameservers:
  • ns1-127.akam.net
  • ns1-88.akam.net
  • asia1.akam.net
  • usw1.akam.net
  • use5.akam.net
Q: Who is the registrar for the Santander.com.br domain?
A: The domain has been registered at BR-NIC.
Q: What is the traffic rank for Santander.com.br?
A: Santander.com.br ranks 9,686 globally on Alexa. Santander.com.br has a High trust score, and a Statvoo Rank of B.
Q: How many people visit Santander.com.br each day?
A: Santander.com.br receives approximately 395,182 visitors and 3,161,456 page impressions per day.
Q: What IP address does Santander.com.br resolve to?
A: Santander.com.br resolves to the IPv4 address 184.29.64.76.
Q: In what country are Santander.com.br servers located in?
A: Santander.com.br has servers located in the France.
Q: What webserver software does Santander.com.br use?
A: Santander.com.br is powered by Unknown webserver.
Q: Who hosts Santander.com.br?
A: Santander.com.br is hosted by Akamai International B.V. in Ile-de-france, Paris, France, 75915.
Q: How much is Santander.com.br worth?
A: Santander.com.br has an estimated worth of $3,413,880. An average daily income of approximately $3,161, which is roughly $96,147 per month.

Santander.com.br Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Santander.com.br Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Santander.com.br

H1 Headings

0 :

H2 Headings

1 :
  1. Conheça as opções que separamos para você

H3 Headings

4 :
  1. Facilite seu dia a dia
  2. Especial para você
  3. Soluções
  4. Apps Santander

H4 Headings

9 :
  1. Créditos e financiamentos Investimentos e previdência Seguros Tarifas e pacotes padronizados Consórcio  
  2. Abra sua Conta Pagamentos e recebimentos Créditos e financiamentos Investimentos Tarifas e pacotes de serviços Pessoa Jurídica Consórcio
  3. Máquina de cartão Getnet Financeira Capitalização
  4. Consultas, informações, transações e cancelamentos. 4004 3535 (capitais e regiões metropolitanas) 0800 702 3535 (demais localidades) 0800 723 5007 (pessoas com deficiência auditiva e de fala) Central de atendimento empresarial 4004 2125 (capitais e regiões metropolitanas) 0800 726 2125 (demais localidades) 0800 723 5007 (pessoas com deficiência auditiva e de fala)
  5. 4004 2262 (capitais e regiões metropolitanas) 0800 704 3722 (demais localidades) Pessoa física: atendimento de segunda a sexta-feira, das 8h às 21h. Sábados das 9h às 16h. Pessoa jurídica: atendimento de segunda a sexta-feira, das 8h às 19h (exceto feriados).
  6. Reclamações, cancelamentos e informações gerais: 0800 762 7777 Atende também pessoas com deficiência auditiva e de fala pelo telefone 0800 771 0401 Ligações do exterior (a cobrar): +55 (11) 3012 3336 SAC (Serviço de Atendimento ao Consumidor) - Fale conosco
  7. Se não ficar satisfeito com a solução apresentada: 0800 726 0322. Disponível de segunda a sexta-feira, das 8h às 22h, e aos sábados, das 9h às 14h, exceto feriado. Atende também pessoas com deficiência auditiva e de fala no 0800 771 0301. Entre em contato com a Ouvidoria
  8. Veja os serviços disponíveis e localize aqui o caixa eletrônico mais próximo
  9. Encontre aqui a agência mais próxima de você

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

0 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Santander.com.br

cartotransformqtranslate0 1qgn07nacional031701 gmtqqserverqqqqcontenttypeqqapplicationjson031702 gmtqqserverqqqqcontenttypeqqapplicationjsone de falanov 2020 031702metropolitanasseusua conta8hdeficiaecircncia auditiva22s9222h45c112s9 2 2atendimento1qgnatende2020 031701 gmtqqserverqqqqcontenttypeqqapplicationjson2h45c11capitais e regiese pacotesexceto8h aagraves723 5007 pessoasmetropolitanaslbr8onlineqqsrcqqdefaultqqhttpscmssantandercombrsiteswpsimagemimagemsliderespecialparavocecartaoonline200429141150pperfcartaoonlinejpgqqlinkqqidqq1499788560704qqlinkqqhttpswwwsantandercombrcartaoonlineqqimageqqtypeqqimagemqqtitleqqsuperamossextafeira dassua empresa7102020 031701deficincia auditivacancelamentosauditiva e2s9abra suatransformqtranslate0 1qgn lpathdeficincia auditiva e6gn0800tambm2h45c11 0falademaispjqqsrcqqdefaultqqhttpscmssantandercombrsiteswpsimagemimagemsliderespecialparavoceavancarpj200727185345paxxxaditamentopacotecomunicacoesprorrogacaobannerimportanteparavoce680x384v2jpgqqlinkqqidqq1499806339182qqlinkqqhttpssantandernegocioseempresascombrutmsourcewebpublicaautmmediumreferralautmcampaignprogramaavancarqqimageqqtypeqqimagemqqtitleqqcartao onlineqqsrcqqdefaultqqhttpscmssantandercombrsiteswpsimagemimagemsliderespecialparavocecartaoonline200429141150pperfcartaoonlinejpgqqlinkqqidqq1499788560704qqlinkqqhttpswwwsantandercombrcartaoonlineqqimageqqtypeqqimagemqqtitleqqsuperamosregies metropolitanas 08002 2h45c11 08h se regiaotildees metropolitanaslbrdemais localidadesjuntosqqsrcqqdefaultqqhttpscmssantandercombrsiteswpsimagemimagemsliderespecialparavocesuperamosjuntos200722195256psuperamosjuntosbotaojpgqqlinkqqidqq1499790548505qqlinkqqhttpsbrsuperamosjuntoscomqqimageqqtypeqqimagemqqtitleqqcarrossele regies metropolitanasdogmtqqserverqqqqcontenttypeqqapplicationjsonnov 2020 031701deficiaecircncia auditiva elocalidadeslbr2020 031702 gmtqqserverqqqqcontenttypeqqapplicationjson031702 gmtqqserverqqqqcontenttypeqqapplicationjson charsetutf8qqkeepaliveqqtimeout5segundaquesregiaotildees metropolitanaslbr gn0800031700para vocappjurdicaserviospara2 2 2h45c11deficiaecircncia031701maxage0qqstricttransportsecurityqqmaxage63072000 includesubdomainsqqxframeoptionsqqdenyqqxxssprotectionqq1ouauditivasantanderregiesbancodas 8hmetropolitanaslbr gn0800lpathregies metropolitanas031701 gmtqqserverqqqqcontenttypeqqapplicationjson charsetutf8qqkeepaliveqqtimeout5vocnorenegociao031700 gmtqqserverqqqqcontenttypeqqapplicationjson charsetutf8qqkeepaliveqqtimeout5includesubdomainsqqxframeoptionsqqdenyqqxxssprotectionqq1suanov 20209honlineqqsrcqqdefaultqqhttpscmssantandercombrsiteswpsimagemimagemsliderespecialparavocecartaoonline200429141150pperfcartaoonlinejpgqqlinkqqidqq1499788560704qqlinkqqhttpswwwsantandercombrcartaoonlineqqimageqqtypeqqimagemqqtitleqqsuperamos juntosqqsrcqqdefaultqqhttpscmssantandercombrsiteswpsimagemimagemsliderespecialparavocesuperamosjuntos200722195256psuperamosjuntosbotaojpgqqlinkqqidqq1499790548505qqlinkqqhttpsbrsuperamosjuntoscomqqimageqqtypeqqimagemqqtitleqqcarrosselsantanderapp29 22s9222zm67254 02h45c11 0 290800 771demais localidadeslbrqqimageqqtypeqqimagemqqtitleqqgetnetqqsrcqqdefaultqqhttpscmssantandercombrsiteswpsimagemimagemgetnet200701215634pgetnetjpgqqlinkqqidqq1499803080627qqlinkqqhttpswwwsupergetcombrutmsourceportalautmmediumimportanteparavoceautmcampaigngetnetqqimageqqtypeqqimagemqqtitleqqavancar pjqqsrcqqdefaultqqhttpscmssantandercombrsiteswpsimagemimagemsliderespecialparavoceavancarpj200727185345paxxxaditamentopacotecomunicacoesprorrogacaobannerimportanteparavoce680x384v2jpgqqlinkqqidqq1499806339182qqlinkqqhttpssantandernegocioseempresascombrutmsourcewebpublicaautmmediumreferralautmcampaignprogramaavancarqqimageqqtypeqqimagemqqtitleqqcartao onlineqqsrcqqdefaultqqhttpscmssantandercombrsiteswpsimagemimagemsliderespecialparavocecartaoonline200429141150pperfcartaoonlinejpgqqlinkqqidqq1499788560704qqlinkqqhttpswwwsantandercombrcartaoonlineqqimageqqtypeqqimagemqqtitleqqsuperamosgmtqqserverqqqqcontenttypeqqapplicationjson charsetutf8qqkeepaliveqqtimeout5sextafeiraregiaotildees metropolitanaslbr12pjqqsrcqqdefaultqqhttpscmssantandercombrsiteswpsimagemimagemsliderespecialparavoceavancarpj200727185345paxxxaditamentopacotecomunicacoesprorrogacaobannerimportanteparavoce680x384v2jpgqqlinkqqidqq1499806339182qqlinkqqhttpssantandernegocioseempresascombrutmsourcewebpublicaautmmediumreferralautmcampaignprogramaavancarqqimageqqtypeqqimagemqqtitleqqcartao0 29 22s9222h45c113telefonefinanceirocapitais0800 726das 9h29brasildascapitais e02 92abra sua conta723 50070 29 22s9222zm672viadas 8h aagravescapitais e regiaotildeeslg4voc ou2020 031700 gmtqqserverqqqqcontenttypeqqapplicationjsondeficinciaregiaotildeessegunda a sextafeira22s9222zm67292 2s929 22s9222h45c11 02mercadoempresasextafeira das 8he031702e regiaotildees92abra22s9222h45c11 02 92centralpessoas com deficinciacharsetutf8qqkeepaliveqqtimeout5opessoas com deficiaecircnciaboletos2 2h45c11metropolitanas 0800553h45c11mais92 2s9 2sedeaagravespessoaspessoa jurdicanov 2020 031700consrcioqqimageqqtypeqqimagemqqtitleqqgetnetqqsrcqqdefaultqqhttpscmssantandercombrsiteswpsimagemimagemgetnet200701215634pgetnetjpgqqlinkqqidqq1499803080627qqlinkqqhttpswwwsupergetcombrutmsourceportalautmmediumimportanteparavoceautmcampaigngetnetqqimageqqtypeqqimagemqqtitleqqavancar pjqqsrcqqdefaultqqhttpscmssantandercombrsiteswpsimagemimagemsliderespecialparavoceavancarpj200727185345paxxxaditamentopacotecomunicacoesprorrogacaobannerimportanteparavoce680x384v2jpgqqlinkqqidqq1499806339182qqlinkqqhttpssantandernegocioseempresascombrutmsourcewebpublicaautmmediumreferralautmcampaignprogramaavancarqqimageqqtypeqqimagemqqtitleqqcartao031700 gmtqqserverqqqqcontenttypeqqapplicationjson553h45c11 0553h45c11 0 29das 8h satendimento de segunda0229 22s9222h45c112 2para sua2020 031700dia02 92 2s90 292s9 207 nov5e regiesfillruleqnonzeroqtransformqtranslate00800nov22s9222h45c11 02localidadesqqimageqqtypeqqimagemqqtitleqqgetnetqqsrcqqdefaultqqhttpscmssantandercombrsiteswpsimagemimagemgetnet200701215634pgetnetjpgqqlinkqqidqq1499803080627qqlinkqqhttpswwwsupergetcombrutmsourceportalautmmediumimportanteparavoceautmcampaigngetnetqqimageqqtypeqqimagemqqtitleqqavancarconta021pjqqsrcqqdefaultqqhttpscmssantandercombrsiteswpsimagemimagemsliderespecialparavoceavancarpj200727185345paxxxaditamentopacotecomunicacoesprorrogacaobannerimportanteparavoce680x384v2jpgqqlinkqqidqq1499806339182qqlinkqqhttpssantandernegocioseempresascombrutmsourcewebpublicaautmmediumreferralautmcampaignprogramaavancarqqimageqqtypeqqimagemqqtitleqqcartao onlineqqsrcqqdefaultqqhttpscmssantandercombrsiteswpsimagemimagemsliderespecialparavocecartaoonline200429141150pperfcartaoonlinejpgqqlinkqqidqq1499788560704qqlinkqqhttpswwwsantandercombrcartaoonlineqqimageqqtypeqqimagemqqtitleqqsuperamos juntosqqsrcqqdefaultqqhttpscmssantandercombrsiteswpsimagemimagemsliderespecialparavocesuperamosjuntos200722195256psuperamosjuntosbotaojpgqqlinkqqidqq1499790548505qqlinkqqhttpsbrsuperamosjuntoscomqqimageqqtypeqqimagemqqtitleqqcarrosselvia de boletospacotesngcontentc47qqgla2020 0317021qgn lpath5007 pessoaspessoa1107 nov 2020maxage0qqstricttransportsecurityqqmaxage630720009

Longtail Keyword Density for Santander.com.br

KeywordsOccurences
07 nov 202014
9-2 2s9 213
2s9 2 213
0-2 9-2 2s913
2h45c11 0 2-910
2 2h45c11 010
2 2 2h45c1110
nov 2020 0317027
031701 gmtqqserverqqqqcontent-typeqqapplicationjson charsetutf-8qqkeep-aliveqqtimeout56
nov 2020 0317016
e de fala6
segunda a sexta-feira6
sexta-feira das 8h6
2020 031701 gmtqqserverqqqqcontent-typeqqapplicationjson6
0 2-9 2-2s-9-2-2-2zm6725
pessoas com deficincia4
723 5007 pessoas4
deficincia auditiva e4
pessoas com deficiaecircncia4
deficiaecircncia auditiva e4
atendimento de segunda4
2020 031700 gmtqqserverqqqqcontent-typeqqapplicationjson3
transformqtranslate0 -1qgn lpath3
capitais e regies3
e regies metropolitanas3
regies metropolitanas 08003
2-2s-9-2-2-2h-45c-11 0-2 9-23
2-9 2-2s-9-2-2-2h-45c-11 0-23
0 2-9 2-2s-9-2-2-2h-45c-113
553h45c11 0 2-93
2020 031702 gmtqqserverqqqqcontent-typeqqapplicationjson3
031702 gmtqqserverqqqqcontent-typeqqapplicationjson charsetutf-8qqkeep-aliveqqtimeout53
031700 gmtqqserverqqqqcontent-typeqqapplicationjson charsetutf-8qqkeep-aliveqqtimeout53
das 8h aagraves3
regiaotildees metropolitanaslbr gn08003
e regiaotildees metropolitanaslbr3
capitais e regiaotildees3
via de boletos3
das 8h s3
nov 2020 0317003
pjqqsrcqqdefaultqqhttpscmssantandercombrsiteswpsimagemimagem-slider-especial-para-voce-avancar-pj20-07-27185345paxxxaditamentopacotecomunicacoesprorrogacaobannerimportanteparavoce680x384v2jpgqqlinkqqidqq1499806339182qqlinkqqhttpssantandernegocioseempresascombrutmsourcewebpublicaautmmediumreferralautmcampaignprogramaavancarqqimageqqtypeqqimagemqqtitleqqcartao onlineqqsrcqqdefaultqqhttpscmssantandercombrsiteswpsimagemimagem-slider-especial-para-voce-cartaoonline20-04-29141150pperfcartaoonlinejpgqqlinkqqidqq1499788560704qqlinkqqhttpswwwsantandercombrcartaoonlineqqimageqqtypeqqimagemqqtitleqqsuperamos juntosqqsrcqqdefaultqqhttpscmssantandercombrsiteswpsimagemimagem-slider-especial-para-voce-superamos-juntos20-07-22195256psuperamosjuntosbotaojpgqqlinkqqidqq1499790548505qqlinkqqhttpsbrsuperamosjuntoscomqqimageqqtypeqqimagemqqtitleqqcarrossel3
qqimageqqtypeqqimagemqqtitleqqgetnetqqsrcqqdefaultqqhttpscmssantandercombrsiteswpsimagemimagem-getnet20-07-01215634pgetnetjpgqqlinkqqidqq1499803080627qqlinkqqhttpswwwsupergetcombrutmsourceportalautmmediumimportanteparavoceautmcampaigngetnetqqimageqqtypeqqimagemqqtitleqqavancar pjqqsrcqqdefaultqqhttpscmssantandercombrsiteswpsimagemimagem-slider-especial-para-voce-avancar-pj20-07-27185345paxxxaditamentopacotecomunicacoesprorrogacaobannerimportanteparavoce680x384v2jpgqqlinkqqidqq1499806339182qqlinkqqhttpssantandernegocioseempresascombrutmsourcewebpublicaautmmediumreferralautmcampaignprogramaavancarqqimageqqtypeqqimagemqqtitleqqcartao onlineqqsrcqqdefaultqqhttpscmssantandercombrsiteswpsimagemimagem-slider-especial-para-voce-cartaoonline20-04-29141150pperfcartaoonlinejpgqqlinkqqidqq1499788560704qqlinkqqhttpswwwsantandercombrcartaoonlineqqimageqqtypeqqimagemqqtitleqqsuperamos3
abra sua conta3
nov 202018
2 215
0-2 9-215
0 2-915
07 nov14
9-2 2s913
2s9 213
max-age0qqstrict-transport-securityqqmax-age63072000 includesubdomainsqqx-frame-optionsqqdenyqqx-xss-protectionqq112
gmtqqserverqqqqcontent-typeqqapplicationjson charsetutf-8qqkeep-aliveqqtimeout512
2 2h45c1110
2h45c11 010
auditiva e8
2020 0317027
capitais e6
031701 gmtqqserverqqqqcontent-typeqqapplicationjson6
2020 0317016
sua conta6
e pacotes6
sexta-feira das6
das 8h6
transformqtranslate0 -1qgn5
2-9 2-2s-9-2-2-2zm6725
0800 7714
723 50074
das 9h4
para voc4
voc ou4
deficiaecircncia auditiva4
deficincia auditiva4
5007 pessoas4
54 03
553h45c11 03
regies metropolitanas3
2-2s-9-2-2-2h-45c-11 0-23
2-9 2-2s-9-2-2-2h-45c-113
metropolitanas 08003
e regies3
sua empresa3
para sua3
pessoa jurdica3
-1qgn lpath3
8h aagraves3
031702 gmtqqserverqqqqcontent-typeqqapplicationjson3
demais localidades3
demais localidadeslbr3
metropolitanaslbr gn08003
regiaotildees metropolitanaslbr3
e regiaotildees3
onlineqqsrcqqdefaultqqhttpscmssantandercombrsiteswpsimagemimagem-slider-especial-para-voce-cartaoonline20-04-29141150pperfcartaoonlinejpgqqlinkqqidqq1499788560704qqlinkqqhttpswwwsantandercombrcartaoonlineqqimageqqtypeqqimagemqqtitleqqsuperamos juntosqqsrcqqdefaultqqhttpscmssantandercombrsiteswpsimagemimagem-slider-especial-para-voce-superamos-juntos20-07-22195256psuperamosjuntosbotaojpgqqlinkqqidqq1499790548505qqlinkqqhttpsbrsuperamosjuntoscomqqimageqqtypeqqimagemqqtitleqqcarrossel3
pjqqsrcqqdefaultqqhttpscmssantandercombrsiteswpsimagemimagem-slider-especial-para-voce-avancar-pj20-07-27185345paxxxaditamentopacotecomunicacoesprorrogacaobannerimportanteparavoce680x384v2jpgqqlinkqqidqq1499806339182qqlinkqqhttpssantandernegocioseempresascombrutmsourcewebpublicaautmmediumreferralautmcampaignprogramaavancarqqimageqqtypeqqimagemqqtitleqqcartao onlineqqsrcqqdefaultqqhttpscmssantandercombrsiteswpsimagemimagem-slider-especial-para-voce-cartaoonline20-04-29141150pperfcartaoonlinejpgqqlinkqqidqq1499788560704qqlinkqqhttpswwwsantandercombrcartaoonlineqqimageqqtypeqqimagemqqtitleqqsuperamos3
qqimageqqtypeqqimagemqqtitleqqgetnetqqsrcqqdefaultqqhttpscmssantandercombrsiteswpsimagemimagem-getnet20-07-01215634pgetnetjpgqqlinkqqidqq1499803080627qqlinkqqhttpswwwsupergetcombrutmsourceportalautmmediumimportanteparavoceautmcampaigngetnetqqimageqqtypeqqimagemqqtitleqqavancar pjqqsrcqqdefaultqqhttpscmssantandercombrsiteswpsimagemimagem-slider-especial-para-voce-avancar-pj20-07-27185345paxxxaditamentopacotecomunicacoesprorrogacaobannerimportanteparavoce680x384v2jpgqqlinkqqidqq1499806339182qqlinkqqhttpssantandernegocioseempresascombrutmsourcewebpublicaautmmediumreferralautmcampaignprogramaavancarqqimageqqtypeqqimagemqqtitleqqcartao3
0800 7263
031700 gmtqqserverqqqqcontent-typeqqapplicationjson3
2020 0317003
8h s3
abra sua3
e44
032
130
santander22
218
nov18
sua17
9-215
0-215
2-915
0714
080013
2s913
seu12
max-age0qqstrict-transport-securityqqmax-age6307200012
includesubdomainsqqx-frame-optionsqqdenyqqx-xss-protectionqq112
charsetutf-8qqkeep-aliveqqtimeout512
das12
gmtqqserverqqqqcontent-typeqqapplicationjson12
para12
atendimento10
lpath10
no10
2h45c1110
o9
voc9
auditiva8
pessoas8
transformqtranslate07
conta7
0317027
pessoa7
demais6
fala6
carto6
0317016
segunda6
sexta-feira6
capitais6
8h6
pacotes6
2-2s-9-2-2-2zm6725
-1qgn5
aagraves5
s5
gn08005
banco4
app4
deficiaecircncia4
34
mais4
44
54
fill-ruleqnonzeroq4
brasil4
9h4
do4
64
74
via4
84
94
104
114
deficincia4
abra4
ou4
que4
exceto4
2-2s-9-2-2-2h-45c-113
servios3
central3
lg3
tambm3
dia3
boletos3
jurdica3
553h45c113
consrcio3
empresa3
renegociao3
cancelamentos3
metropolitanas3
123
0317003
mercado3
telefone3
atende3
financeiro3
sede3
nacional3
santanderapp3
qqimageqqtypeqqimagemqqtitleqqgetnetqqsrcqqdefaultqqhttpscmssantandercombrsiteswpsimagemimagem-getnet20-07-01215634pgetnetjpgqqlinkqqidqq1499803080627qqlinkqqhttpswwwsupergetcombrutmsourceportalautmmediumimportanteparavoceautmcampaigngetnetqqimageqqtypeqqimagemqqtitleqqavancar3
regies3
pjqqsrcqqdefaultqqhttpscmssantandercombrsiteswpsimagemimagem-slider-especial-para-voce-avancar-pj20-07-27185345paxxxaditamentopacotecomunicacoesprorrogacaobannerimportanteparavoce680x384v2jpgqqlinkqqidqq1499806339182qqlinkqqhttpssantandernegocioseempresascombrutmsourcewebpublicaautmmediumreferralautmcampaignprogramaavancarqqimageqqtypeqqimagemqqtitleqqcartao3
onlineqqsrcqqdefaultqqhttpscmssantandercombrsiteswpsimagemimagem-slider-especial-para-voce-cartaoonline20-04-29141150pperfcartaoonlinejpgqqlinkqqidqq1499788560704qqlinkqqhttpswwwsantandercombrcartaoonlineqqimageqqtypeqqimagemqqtitleqqsuperamos3
juntosqqsrcqqdefaultqqhttpscmssantandercombrsiteswpsimagemimagem-slider-especial-para-voce-superamos-juntos20-07-22195256psuperamosjuntosbotaojpgqqlinkqqidqq1499790548505qqlinkqqhttpsbrsuperamosjuntoscomqqimageqqtypeqqimagemqqtitleqqcarrossel3
localidades3
regiaotildees3
metropolitanaslbr3
localidadeslbr3
ngcontent-c47qqgla3

Who hosts Santander.com.br?

Santander.com.br Hosting Provider Information

Hosted IP Address:184.29.64.76
Hosted Hostname:a184-29-64-76.deploy.static.akamaitechnologie
Service Provider:Akamai International B.V.
Hosted Country:FranceFR
Location Latitude:48.8534
Location Longitude:2.3488
Webserver Software:unknown

Is "Akamai International B.V." in the Top 10 Hosting Companies?

Name
Percentage
Unknown
15.7989%
GOOGLE
14.3607%
AS-26496-GO-DADDY-COM-LLC
3.8534%
NAMECHEAP-NET
3.1479%
AMAZON-AES
2.3132%
GoDaddy.com, LLC
2.0763%
UNIFIEDLAYER-AS-1
1.9874%
Fara Negar Pardaz Khuzestan
1.6407%
CONFLUENCE-NETWORK-INC
1.4732%
1&1 Internet AG
1.3797%
Akamai International B.V.
0.0057%

HTTP Header Analysis for Santander.com.br

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
X-Content-Type-Options: nosniff
X-XSS-Protection: 1; mode=block
X-Frame-Options: SAMEORIGIN
Content-Type: text/html; charset=utf-8
ETag: W/"3f99a-Ud6AjJ15LOezdxnSJRAIfFebaNI:dtagent10193200707165720hXss:dtagent10193200707165720hXss"
Content-Encoding: gzip
X-OneAgent-JS-Injection: true
X-ruxit-JS-Agent: true
Strict-Transport-Security: max-age=31536000; includeSubDomains
Content-Length: 42980
Cache-Control: private, max-age=473
Date: Sat, 07 Nov 2020 04:08:44 GMT
Connection: keep-alive
Vary: Accept-Encoding

Santander.com.br Domain Nameserver Information

HostIP AddressCountry
ns1-127.akam.net 193.108.91.127
ns1-88.akam.net 193.108.91.88
asia1.akam.net 95.100.175.64
usw1.akam.net 23.61.199.66
use5.akam.net 2.16.40.64


Need to find out who hosts Santander.com.br?


Domain Registration (WhoIs) information for Santander.com.br

 % Copyright (c) Nic.br
% The use of the data below is only permitted as described in
% full by the terms of use at https://registro.br/termo/en.html ,
% being prohibited its distribution, commercialization or
% reproduction, in particular, to use it for advertising or
% any similar purpose.
% 2020-10-09T18:30:13-03:00 - IP: 165.232.41.238

domain: santander.com.br
owner: Banco Santander (Brasil) S.A.
owner-c: MAMGA18
tech-c: MAMGA18
nserver: use5.akam.net
nsstat: 20201007 AA
nslastaa: 20201007
nserver: usw1.akam.net
nsstat: 20201007 AA
nslastaa: 20201007
nserver: ns1-88.akam.net
nsstat: 20201007 AA
nslastaa: 20201007
nserver: ns1-127.akam.net
nsstat: 20201007 AA
nslastaa: 20201007
nserver: asia1.akam.net
nsstat: 20201007 AA
nslastaa: 20201007
created: 19961223 #26457
changed: 20191224
expires: 20201223
status: published

nic-hdl-br: MAMGA18
person: Marcos Martins Galuzzi
created: 20090312
changed: 20180109

% Security and mail abuse issues should also be addressed to
% cert.br, http://www.cert.br/ , respectivelly to Login to show email
and Login to show email
whois.registro.br accepts only direct match queries. Types
% of queries are: domain (.br), registrant (tax ID), ticket,
% provider, CIDR block, IP and ASN.

Websites with Similar Names

Santa-21.com
さんた工房
Santa-agata.com
Santa Agata
Santa-ageingcare.com
santa-ageingcare.com – ??????????.com??????????
Santa-ageingcarepackage.com
santa-ageingcarepackage.com – ??????????.com??????????
Santa-air.com
Home - Santa Air Refrigeration & Airconditioning Services
Santa-all-year.com
502 Bad Gateway
Santa-ana-appliance.net
Appliance Repair Santa Ana | Appliance Service Santa Ana CA | Santa Ana Appliance Repair
Santa-ana-dentist.com
Santa Ana Dentist

Recently Updated Websites

Interiorlandscape.com (4 seconds ago.)Liverpool.service-now.com (7 seconds ago.)Agd-sfv.de (8 seconds ago.)Lifenergyheal.com (10 seconds ago.)Wis.de (13 seconds ago.)3tr.cc (14 seconds ago.)Carechoir.com (17 seconds ago.)Ciclosycaravanasoiartzun.com (20 seconds ago.)Marlugioielli.it (24 seconds ago.)Lastwordmovie.com (24 seconds ago.)Enjoymywebinar.com (25 seconds ago.)Hayeskleinlaw.com (29 seconds ago.)Idcouncil.com (29 seconds ago.)Valorproperty.com (29 seconds ago.)Themusicianear.com (31 seconds ago.)Caribbeanride.com (35 seconds ago.)Kittystate.com (38 seconds ago.)Jaunix.com (41 seconds ago.)Baobovip136.app (42 seconds ago.)Jenjiyoga.com (45 seconds ago.)Inspirefcdc.fans (52 seconds ago.)Tahoesands.org (54 seconds ago.)A4m.international (54 seconds ago.)Wright-words.com (56 seconds ago.)Vende.global (56 seconds ago.)Pioneerenvironmental.com (58 seconds ago.)Svr3ilo.com (58 seconds ago.)Plgjj.com (59 seconds ago.)Avisi.ru (1 minute 1 second ago.)Die-rote-fahne.de (1 minute 2 seconds ago.)

Recently Searched Keywords

600tk each goal (1 second ago.)vitónica (1 second ago.)japanese girls porn (1 second ago.)dave matthews band (3 seconds ago.)beaute clean découvrez notre sélection (4 seconds ago.)07:50amazing cock suckers jodi taylor, kassius kay, alex chance gives a stout blowjob (5 seconds ago.)turkuaz restaurant (5 seconds ago.)judge throws out trump campaign’s pennsylvania lawsuit (5 seconds ago.)piranha (6 seconds ago.)bayer 04 leverkusen (6 seconds ago.)openness (7 seconds ago.)pmticn makkilavuzu din371 (8 seconds ago.)k ob318uacutebenyacutem ryacutechly (8 seconds ago.)especie (9 seconds ago.)windowopen jquerydocumenton (10 seconds ago.)quynh le chef (10 seconds ago.)mula dalaman karaal (10 seconds ago.)shopinia woocommerce theme (11 seconds ago.)bülbüloğlu bülbül (11 seconds ago.)mastrubasie 86399 (12 seconds ago.)展厅现象 (14 seconds ago.)arraysf546015fce2e1c4715f iftypeofekomiwidgetjs (14 seconds ago.)nisanbet giriş (14 seconds ago.)vehicle courses (15 seconds ago.)kota palangkaraya (16 seconds ago.)mycenae (16 seconds ago.)oto (17 seconds ago.)zsh command not found (18 seconds ago.)soft diffuser (20 seconds ago.)macro tubeler (21 seconds ago.)