Satyaloktechnologies.in  |  IT Company| Web Development| Website Design| SEO Company| Project Training Ahmedabad| PHP Training in Ahmedabad
Low trust score  | 
Satyalok Technologies deals in Project Training, Web Design Services, Web Development Services, Internet Marketing, Brochure Designing, SEO Services, Android Apps Development, ERP Marketing, and Web Hosting with addition to PHP Training and Specialized Training Services at Ahmedabad - India.




Satyaloktechnologies.in Website Information

Website Ranks & Scores for Satyaloktechnologies.in

Statvoo Rank Statvoo Rank:H
Alexa Rank Alexa Rank:530,717
Majestic Rank Majestic Rank:0
Domain Authority Domain Authority:19%
DMOZ DMOZ Listing:No

Whois information for satyaloktechnologies.in

Full Whois Lookup for Satyaloktechnologies.in Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Satyaloktechnologies.in. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Access to .IN WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the .IN registry database. The data in this record is provided by .IN Registry for informational purposes only, and .IN does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. .IN reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.

Domain ID:D8065285-AFIN
Domain Name:SATYALOKTECHNOLOGIES.IN
Created On:21-Jan-2014 18:06:02 UTC
Last Updated On:22-Jan-2017 18:20:20 UTC
Expiration Date:21-Jan-2018 18:06:02 UTC
Sponsoring Registrar:Endurance Domains Technology LLP (R173-AFIN)
Status:CLIENT TRANSFER PROHIBITED
Reason:
Registrant ID:WIQ_28949897
Registrant Name:shreeji
Registrant Organization:shreejieng
Registrant Street1:bapunager
Registrant Street2:bapunager
Registrant Street3:bapunager
Registrant City:ahmedabad
Registrant State/Province:Gujarat
Registrant Postal Code:380007
Registrant Country:IN
Registrant Phone:+91.9998446614
Registrant Phone Ext.:
Registrant FAX:
Registrant FAX Ext.:
Registrant Login to show email
ID:WIQ_28949897
Admin Name:shreeji
Admin Organization:shreejieng
Admin Street1:bapunager
Admin Street2:bapunager
Admin Street3:bapunager
Admin City:ahmedabad
Admin State/Province:Gujarat
Admin Postal Code:380007
Admin Country:IN
Admin Phone:+91.9998446614
Admin Phone Ext.:
Admin FAX:
Admin FAX Ext.:
Admin Login to show email
ID:WIQ_28949897
Tech Name:shreeji
Tech Organization:shreejieng
Tech Street1:bapunager
Tech Street2:bapunager
Tech Street3:bapunager
Tech City:ahmedabad
Tech State/Province:Gujarat
Tech Postal Code:380007
Tech Country:IN
Tech Phone:+91.9998446614
Tech Phone Ext.:
Tech FAX:
Tech FAX Ext.:
Tech Login to show email
Server:NS1-BHARAT.EWEBGURU.COM
Name Server:NS2-BHARAT.EWEBGURU.COM
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
DNSSEC:Unsigned

Who hosts Satyaloktechnologies.in?

Satyaloktechnologies.in is hosted by Tierpoint, LLC in Washington, Seattle, United States, 98109.
Satyaloktechnologies.in has an IP Address of 67.222.16.168 and a hostname of host.seawind.co.in.



Satyaloktechnologies.in Web Server Information

Hosted IP Address:67.222.16.168
Hosted Hostname:host.seawind.co.in
Service Provider:Tierpoint, LLC
Hosted Country:United StatesUS
Location Latitude:47.6344
Location Longitude:-122.3422
Webserver Software:Not Applicable

HTTP Header Analysis for Satyaloktechnologies.in

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Sun, 06 Sep 2015 03:47:31 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
X-Powered-By: PHP/5.5.25
X-Cache: HIT from Backend
Content-Encoding: gzip


Need to find out who hosts Satyaloktechnologies.in?

Satyaloktechnologies.in Free SEO Report

Website Inpage Analysis for Satyaloktechnologies.in

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Satyaloktechnologies.in

satyalok technologiesalllanguageclientsexpert seobusinessdevelopment ourwhichdisplaydivslideshowpagetechnicalmarketingdivnavcontrolsinternetlisoftwarereadregistrationemaildisplaynoneenabledinternet marketingourecommercetrainingslideshowulthumbsyourdesigninggallerytesting training0pxsourcedomain registrationdivcontentsatyalokwebsitesolutionshaveimgemail marketingsetdivpaginationshouldyouseo0ulthumbs liwespantechnologiesheightmetusvivamusteamdivnavigationtruewebcss3testingdevelopment5pxcontentyour businessexperiencethisfindulthumbs liavailablesuchbestturpissolutions to ourtextdecorationapplicationmoresupportet0 0facebookexperterpservicesecommerce developmentthumbsprojectnorepeatprovidingnonehtml5domainread morethisfindulthumbsgreatfloatnorepeat 0ahmedabadusfelis

Longtail Keyword Density for Satyaloktechnologies.in

KeywordsOccurences
solutions to our3
read more13
satyalok technologies4
testing training4
no-repeat 04
expert seo3
your business3
development our3
domain registration3
thisfindulthumbs li3
ulthumbs li3
internet marketing3
e-commerce development3
0 03
email marketing3
training22
web16
development15
more15
read13
our13
designing13
012
services11
divcontent9
marketing9
your9
us8
website8
have7
divpagination7
divslideshow7
clients7
we6
li6
slideshow6
img5
divnav-controls5
divnavigation5
display5
testing5
gallery5
satyalok5
solutions5
page5
seo5
business5
turpis4
ulthumbs4
providing4
best4
true4
thumbs4
experience4
technologies4
should4
text-decoration4
all4
5px4
source4
e-commerce4
email4
no-repeat4
great3
software3
erp3
ahmedabad3
you3
application3
technical3
language3
html53
css33
felis3
et3
facebook3
such3
vivamus3
metus3
support3
expert3
0px3
displaynone3
span3
none3
float3
set3
height3
enabled3
which3
internet3
registration3
domain3
project3
content3
thisfindulthumbs3
team3
available3

What are the nameservers for satyaloktechnologies.in?

Satyaloktechnologies.in Domain Nameserver Information

HostIP AddressCountry
ns1.seawind.co.in 67.222.16.168United States United States
ns2.seawind.co.in 67.222.17.168United States United States

Satyaloktechnologies.in Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Satyaloktechnologies.in is a scam?