Savefrom.net  |  Free Online YouTube Downloader: Download YouTube Videos, Facebook and many others!
High trust score  | 
Free Online service to Download YouTube videos at one click! The best YouTube Downloader supporting fast and easy vimeo, Facebook and Dailymotion video Download and much more!

Savefrom.net Website Information

Savefrom.net has a High trust score, a Statvoo Rank of B, an Alexa Rank of 129, a Majestic Rank of 11,807, a Domain Authority of 72% and is not listed in DMOZ.

Savefrom.net is hosted by Hosting Services Inc in United Kingdom.
Savefrom.net has an IP Address of 146.185.29.13 and a hostname of uk.node.quickweb.co.nz.

The domain savefrom.net was registered 1 decade 1 year 7 months ago by , it was last modified 4 years 6 months 14 hours ago and currently is set to expire 4 months 2 weeks 4 days from now.


Whois information for savefrom.net

Full Whois Lookup for Savefrom.net Whois Lookup

Domain Name: SAVEFROM.NET
Registry Domain ID: 1421168340_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2017-03-13T20:31:35Z
Creation Date: 2008-03-12T19:50:58Z
Registry Expiry Date: 2023-03-12T19:50:58Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS-1134.AWSDNS-13.ORG
Name Server: NS-1693.AWSDNS-19.CO.UK
Name Server: NS-182.AWSDNS-22.COM
Name Server: NS-964.AWSDNS-56.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-08-19T00:19:11Z

Who hosts Savefrom.net?

Savefrom.net Web Server Information

Hosted IP Address:146.185.29.13
Hosted Hostname:uk.node.quickweb.co.nz
Service Provider:Hosting Services Inc
Hosted Country:United KingdomGB
Location Latitude:51.4964
Location Longitude:-0.1224
Webserver Software:Not Applicable

HTTP Header Analysis for Savefrom.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Mon, 08 Jun 2015 02:21:34 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Keep-Alive: timeout=25
Vary: Accept-Encoding
X-Powered-By: PHP/5.3.29
Content-Encoding: gzip


Need to find out who hosts Savefrom.net?

Savefrom.net Free SEO Report

Website Inpage Analysis for Savefrom.net

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Savefrom.net

foptionsuid sfstatsuidbrowser4urlvideo downloadersfbrowsernamesfresultcssdisplay block returnyou1 ifnameuvdpromo2videoidblock return ifresultfullhddelimiterqualitypoldrunh70optionall1 maxthisexpvalue 2helperexperimentstrue return falsesafetargetinitvideo from serviceif sflangpagecheckcountrycountrywindowgathisgatrackername setactionsisecondbtnvideo multimulti nodeshowresulthostingmainformboxthisvideoidsflangbox uvdssyoutubeh18send event vidachamac osif sfosname windowsfalsevideoid uvdpromo2urluvdpromo2videoid videoideventcategory eventactionvideoid uideslideupfast functionnew experimentsflang en returnwindowyandexmetrikaexperiment nameeventactionfunction resultvideoiduid1 returnvar trackersfosname macosnameinsteadeslideupfasttelevzrreturn stopanameprevvalueif resultperiodactionsif thisssyoutubeexpvaluedatasetformthistelevzrurlvar videoiddownloadingnovar selectorevent hdstoreidinitssyoutuberecurrentpaymentsvideoid uvdpromo2videoidresultvidachareturn true functionsfresultaddresultcallbackfunction resulttier1cvsfstatsyametrikaenabledvideoeventcategoryhrefeventcountrysfstatsuiduvdpromo2videoid videoid uvdpromo2urlresult video multisend event eventcategorythisisstoppedtarget blanktrue ifviamacskutelevzrmacdropdownlisthtmlmin 1videoid returndimension1 cidsfopenxenabledmaxreturn 0thisreadyhd or musicummy paidsend event vidachabottomif option tier1thisssyoutubewindowgauvdpromo2getgatrackernamethisexpvaluecarouselbannerwinskuox7event vidachabottomlinks actions titlefull hd 4kgetmultivar elwindowgarunattrdownload videoonefunction eventfull hds41 url decodeuricomponenturlbutwindowgathisgatrackernamefunction ifurl decodeuricomponenturltier2installhref thistelevzrurlgethelperdownloadboxinitssyoutuberecurrentpaymentsvideoidgapropertyfalse ifsfhashurl uvdpromo2chooseoptionfunctiondownloadclicknullvaluesafariif countryelcarouselbannermacskulinkboxexpandthisgacidvaluedownload full hd7body onclickstopdefbtnboxwindowgatracker send eventevent eventcategoryuvdpromo2urlreturn ifeventpreventdefaultvidacha showshowformvideo hostingvidlangjsinstallnowremove1uvdpromo2chooseoptionsavefromnet helperthispnewfunctionesavefromnetmeresult videoselectordata ifsfresultaddresultcallbackfunctionmusicalinkdownloadnew experiment name2isavailabledownloadthisexpvalue 1windowgauvdpromo2getgatrackername sendyoutubetextvia ummy paidevent downloadingevent vidacha showinputtarget blank dataqualityevent vidachalinkgroupid08title videorunh21videoidfreeinputnamesfurlvalthisurlexp new experimentinitssyoutuberecurrentpaymentsvideoid uvdpromo2videoid videoidthisgatrackernamelist eslideupfast functionif windowganodevar boxplayerlinkswatchifvideoid videoiddimension1easiersetform functionthanecpnewhd 4khd var1uvdpromo2url sfhashurl5sfcountryinit initssyoutuberecurrentpaymentsvideoidevent hd var19typethisonlinkclickthisfunctionevent varvideosgetchinadimensiondownloader1 urlfunction datadownload from serviceelattrdataqualityfunction varsupportedblocksfcarouselbannerdatauvdnewextraosvideoid uid sfstatsuid12list eslideupfastfullcv maxset dimension1youtubetextviatnamepriceeummyel elservicenbspmusic from youtubetextvia6actionsi else iffunction data ifpartnersbodyonclicknode varactionsiyoursmallboxtruesfresultcssdisplay nonemacvidachabottomsrcactionsigroupdecodeuricomponenturluvdpromo2ssyoutubehttpsvideodownloaderummynetcheckoutmediahtmlskusetform returnif thisexpvalue 1detailsinittelevzrdesktopyoutubetextvia ummysend event hdsfcarouselbannerdatauvdnewwindowgathistrackerinitrecurrentpaymentsskuexplinks actionsmin 1 maxsfresultfunction elthispoldmainresourcesvar1sfcarouselbannerwindowgauvdpromo2getgatrackername send eventenjoyoptionparamdategettimesetelse if thisexpvalueuvdssyoutubeh18send event downloadingreturnsdataqualitynew dategettimehtml bodyanimatescrolltoptelevzrdownloadlink3boxidpageviews4 s4 s4return falseinit initssyoutuberecurrentpaymentsvideoid uvdpromo2videoidsfif countervar counterboxusethiscarouselreturn false ifwindowssfhashurlnewvideo multi nodedownloadclick elattrdataqualityclass0 returnsfosname mac ostrackerwinskubuttonif cid1080pbodyvideoid uvdpromo2url sfhashurlwantreturn functionexp newskusfosnameif resultfullhditssfstatsuid ifreturnelse iffunction result videoif checkcountrycountrygatrackernameactions title videovar exp newtrue functionelseclicktier2 returnmulti node vartelevzrmacdropdownplaceholderelse if sfosnamelinks linkgroupreturn vartelevzr applabelsfresultcssdisplaygatrackeventslinkqualitylinkfirstlinktitledomainsfhashurl uvdpromo2chooseoption functiondosfautosubmitformsfsubmitsend eventuvdpromo2ssyoutube falsecounteruvdpromo2url sfhashurl uvdpromo2chooseoptionenableonclick linkboxminel var elblank dataqualityvariantnonemaxqualityvar el elreturn truessyoutubeif thisexpvaluewindowgatrackervarmonthfunctionevent eventpreventdefaultevenpleaseif optionhdnode ifvar expoption tier1ebuttonwebtry0 return ifone clicklimitationsproporsionhostingresultboxsfosname windowsmorewindowgagatrackernamethismaxqualityjustpaidfunctioneventreturn true returnexperimentdefbtnnames4 s4expgetvalueif videoid videoid11if actionsigroupactionsi elsedownload fullactions titlevar urlif sfosnamesubnamelistourappblankel varuvdpromo2chooseoption functiontextyoutubeif thisexpvalue 2if videoidsupported resourcesif sfosname macsettimeoutfunctiontrue returnvar skuyour videothissetimagewindowgathistracker sendsfresultcssdisplay blockalinkdownload function eventemptyblock returnwindowgatracker sendtitle video hostingcidsendalinkdownload functionsfresultaddresultcallbackfunction result videofooterv210send pageviewlinkboxbodyanimatescrolltop4ksfopenxenabled falselinkdownloadmetawindowgathistracker send eventonclick

Longtail Keyword Density for Savefrom.net

KeywordsOccurences
windowgathistracker send event13
send event eventcategory9
video multi node8
sfosname mac os8
sfresultcssdisplay block return7
result video multi7
if sfosname windows7
s4 s4 s46
if sfosname mac6
return false if6
download full hd5
else if sfosname5
block return if5
full hd 4k5
actions title video4
videoid uid sfstatsuid4
return true function4
send event downloading4
send event hd4
title video hosting4
actionsi else if4
event hd var14
download from service4
if thisexpvalue 24
windowgatracker send event4
videoid uvdpromo2url sfhashurl4
hd or music4
uvdpromo2videoid videoid uvdpromo2url4
sfhashurl uvdpromo2chooseoption function3
youtubetextvia ummy paid3
var el el3
send event vidacha-bottom3
music from youtubetextvia3
initssyoutuberecurrentpaymentsvideoid uvdpromo2videoid videoid3
el var el3
windowgauvdpromo2getgatrackername send event3
if option tier13
init initssyoutuberecurrentpaymentsvideoid uvdpromo2videoid3
uvdpromo2url sfhashurl uvdpromo2chooseoption3
links actions title3
var exp new3
exp new experiment3
new experiment name3
min 1 max3
sflang en return3
video from service3
function data if3
-1 url decodeuricomponenturl3
if videoid videoid3
list eslideupfast function3
sfresultaddresultcallbackfunction result video3
if thisexpvalue 13
send event vidacha3
event vidacha show3
0 return if3
alink-download function event3
multi node var3
function result video3
else if thisexpvalue3
return true return3
true return false3
target blank data-quality3
send event24
return if22
return false17
else if15
if sfosname14
windowgathistracker send13
function var13
false if11
video multi11
return true11
if sflang10
full hd10
event eventcategory9
sfosname windows9
if thisexpvalue9
sfresultcssdisplay block9
functionevent eventpreventdefault8
mac os8
if option8
sfosname mac8
if videoid8
function if8
multi node8
savefromnet helper7
0 return7
function event7
s4 s47
return var7
block return7
result video7
var box6
ummy paid6
body onclick6
one click5
download full5
function result5
hd 4k5
download video5
true function5
uid sfstatsuid5
-1 return4
if result4
true return4
actions title4
target blank4
el var4
box uvd-ssyoutube-h184
downloadclick elattrdata-quality4
videoid uid4
event downloading4
title video4
video hosting4
if actionsigroup4
actionsi else4
thisexpvalue 24
uvdpromo2videoid videoid4
windowgatracker send4
min 14
1 return4
true if4
functionevent var4
var url4
if checkcountrycountry4
1 if4
function data4
event hd4
init initssyoutuberecurrentpaymentsvideoid4
uvdpromo2url sfhashurl4
hd var14
videoid uvdpromo2url4
return function3
if cid3
set dimension13
cv max3
send pageview3
windowgathisgatrackername set3
youtubetextvia ummy3
if counter3
dimension1 cid3
if thisssyoutube3
eventcategory eventaction3
uvdpromo2chooseoption function3
var sku3
option tier13
windowgauvdpromo2getgatrackername send3
if country3
var counter3
sfstatsuid if3
initssyoutuberecurrentpaymentsvideoid uvdpromo2videoid3
html bodyanimatescrolltop3
return stop3
tier2 return3
uvdpromo2ssyoutube false3
sfhashurl uvdpromo2chooseoption3
var tracker3
event vidacha3
video downloader3
1 url3
onclick link-box3
if windowga3
return 03
var exp3
experiment name3
new experiment3
exp new3
eslideupfast function3
list eslideupfast3
-1 url3
setform function3
data if3
setform return3
url decodeuricomponenturl3
var videoid3
televzr app3
your video3
videoid videoid3
1 max3
sfopenxenabled false3
href thistelevzrurl3
function el3
videoid return3
new dategettime3
blank data-quality3
if resultfullhd3
el el3
var el3
links link-group3
alink-download function3
supported resources3
thisexpvalue 13
node if3
sfresultaddresultcallbackfunction result3
var selector3
node var3
links actions3
sfresultcssdisplay none3
vidacha show3
event vidacha-bottom3
if251
function126
var116
return115
true46
video40
038
false38
event36
videoid35
download35
else35
132
hd29
send27
eventcategory22
onclick21
sfosname19
url18
savefromnet18
result18
ummy17
quality16
functionevent16
option16
id15
max14
your14
new14
thisexpvalue14
node14
browser14
214
click14
313
multi13
windowgathistracker13
name13
eventaction12
show12
sfresultcssdisplay12
install12
sflang12
min11
block11
counter11
get11
sku10
mac10
box10
el10
full10
value9
links9
s49
thismaxquality9
os9
href9
windows9
data9
49
you9
text9
eventpreventdefault9
attr9
pnew9
uvd-ssyoutube-h188
service8
country8
helper8
cid8
sfhashurl8
settimeoutfunction8
gatrackername8
downloader8
winsku7
setform7
tier17
pold7
all7
paid7
downloading7
list7
macsku7
free7
firstlink7
title7
type7
57
vid7
body7
null7
hosting6
uvdpromo2videoid6
none6
subname6
cv6
maxquality6
actions6
elattrdata-quality6
use6
experiment6
options6
selector6
66
init6
link6
sfstatsuid6
one6
app6
televzr6
html6
4k6
televzr-download-link5
thistelevzrurl5
e5
more5
75
stop5
prevvalue5
button5
target5
downloadclick5
than5
uid5
price5
windowgathisgatrackername5
set5
checkcountrycountry5
tracker5
initssyoutuberecurrentpaymentsvideoid5
gaproperty5
web5
storeid5
vidacha-bottom5
class5
experiments5
no5
youtube5
expvalue5
85
its5
even4
thisready4
ssyoutube4
thisgatrackername4
linkquality4
param4
data-quality4
blank4
mainformbox4
smallbox4
dimension14
our4
gatrackevents4
tier24
1080p4
carouselbannermacsku4
carouselbannerwinsku4
page4
windowgagatrackername4
sfcountry4
partners4
src4
music4
94
windowgatracker4
uvdpromo2ssyoutube4
getchinadimension4
lang4
nbsp4
var14
label4
uvdpromo2chooseoption4
uvdpromo2url4
videos4
safe4
thisisstopped4
vidacha4
104
actionsigroup4
actionsisecond-btn4
actionsi4
safari4
sfstatsyametrikaenabled4
sfresult4
want4
me4
114
sfopenxenabled4
input4
result-box4
thisonlinkclickthis4
link-download4
domain4
sfresultaddresultcallbackfunction3
please3
do3
initrecurrentpaymentssku3
windowgauvdpromo2getgatrackername3
period3
footer-v-23
boxid3
televzr-mac-dropdown-placeholder3
watch3
delimiter3
tname3
try3
returns3
windowyandexmetrika3
televzr-mac-dropdown-list3
ec3
osname3
inittelevzrdesktop3
sfcarouselbannerdatauvdnew3
sf3
expgetvalue3
sfcarouselbannerdatauvdnewextra3
ox73
exp3
proporsion3
youtubetextvia3
runh70option3
runh21videoid3
isavailable3
gethelperdownloadbox3
sfcarouselbanner3
empty3
httpsvideodownloaderummynetcheckout-mediahtmlsku3
resulthosting3
enable3
main3
thisvideoid3
js-install-nowremove3
run3
via3
just3
thiscarousel3
limitations3
showform3
windowga3
but3
f3
link-group3
supported3
link-boxexpand3
eslideupfast3
aname3
def-btn-box3
alink-download3
easier3
functione3
resultfullhd3
resources3
link-box3
sfautosubmitformsfsubmit3
decodeuricomponenturl3
pageview3
enjoy3
instead3
ebutton3
bodyanimatescrolltop3
thisgacidvalue3
details3
dategettime3
thissetimage3
inputnamesfurlvalthisurl3
thispnew3
meta3
sfbrowsername3
123
def-btn-name3
variant3
bodyonclick3
thispold3
thisssyoutube3
month3
player3

What are the nameservers for savefrom.net?

Savefrom.net Domain Nameserver Information

HostIP AddressCountry
ns10.dnsmadeeasy.com 208.94.148.4United States United States
ns11.dnsmadeeasy.com 208.80.124.4United States United States
ns12.dnsmadeeasy.com 208.80.126.4United States United States
ns13.dnsmadeeasy.com 208.80.125.4United States United States
ns14.dnsmadeeasy.com 208.80.127.4United States United States
ns15.dnsmadeeasy.com 208.94.149.4United States United States

Savefrom.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Savefrom.net is a scam?