Saveontyres.co.uk Favicon Saveontyres.co.uk

Saveontyres.co.uk Website Thumbnail
Checking...
Cheap Tyres • Save on Tyres
Low trust score
Add a review Change category Claim this site
We recommend you always check your manufacturers handbook when selecting your tyre choice.Search by Registration or Tyre size to select the right tyres for


Domain summary

Domain label
saveontyres
Domain extension
co.uk
Domain registered:
08-Nov-2004
Domain updated:
21-Jul-2020
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is saveontyres.co.uk ranked relative to other sites:

Percentage of visits to saveontyres.co.uk from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Saveontyres.co.uk registered?
A: Saveontyres.co.uk was registered 15 years, 11 months, 3 weeks, 7 hours, 48 minutes, 37 seconds ago on Monday, November 8, 2004.
Q: When was the WHOIS for Saveontyres.co.uk last updated?
A: The WHOIS entry was last updated 3 months, 1 week, 1 day, 7 hours, 48 minutes, 37 seconds ago on Tuesday, July 21, 2020.
Q: What are Saveontyres.co.uk's nameservers?
A: DNS for Saveontyres.co.uk is provided by the following nameservers:
  • dns1.as12513.net
  • dns1.eclipse.net.uk
  • dns2.as12513.net
Q: Who is the registrar for the Saveontyres.co.uk domain?
A: The domain has been registered at Nominet UK.
Q: What is the traffic rank for Saveontyres.co.uk?
A: Saveontyres.co.uk has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Saveontyres.co.uk each day?
A: Saveontyres.co.uk receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Saveontyres.co.uk resolve to?
A: Saveontyres.co.uk resolves to the IPv4 address 35.214.13.181.
Q: In what country are Saveontyres.co.uk servers located in?
A: Saveontyres.co.uk has servers located in the United States.
Q: What webserver software does Saveontyres.co.uk use?
A: Saveontyres.co.uk is powered by Nginx webserver.
Q: Who hosts Saveontyres.co.uk?
A: Saveontyres.co.uk is hosted by Merit Network Inc. in California, Mountain View, United States, 94043.
Q: How much is Saveontyres.co.uk worth?
A: Saveontyres.co.uk has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Saveontyres.co.uk?

Saveontyres.co.uk Hosting Provider Information

Hosted IP Address:35.214.13.181
Hosted Hostname:181.13.214.35.bc.googleusercontent.com
Service Provider:Merit Network Inc.
Hosted Country:United StatesUS
Location Latitude:37.4043
Location Longitude:-122.0748
Webserver Software:nginx

Is "Merit Network Inc." in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Saveontyres.co.uk

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Server: nginx
Date: Mon, 19 Oct 2020 12:38:27 GMT
Content-Type: text/html; charset=iso-8859-1
Content-Length: 367
Connection: keep-alive
Location: https://saveontyres.co.uk/
alt-svc: quic=":443"; ma=86400; v="43,39"
Host-Header: 5d77dd967d63c3104bced1db0cace49c
X-Proxy-Cache: MISS

Saveontyres.co.uk Domain Nameserver Information

HostIP AddressCountry
dns1.as12513.net 212.104.130.11
dns1.eclipse.net.uk 212.104.129.11
dns2.as12513.net 212.104.130.67


Need to find out who hosts Saveontyres.co.uk?


WhoIs information for Saveontyres.co.uk

 Domain name:
saveontyres.co.uk

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 12-Feb-2020

Registrar:
Eclipse Networking Ltd t/a Eclipse Internet [Tag = ECLIPSE]
URL: http://www.eclipse.net.uk

Relevant dates:
Registered on: 08-Nov-2004
Expiry date: 08-Nov-2021
Last updated: 21-Jul-2020

Registration status:
Registered until expiry date.

Name servers:
dns1.as12513.net
dns1.eclipse.net.uk
dns2.as12513.net

WHOIS lookup made at 22:24:58 14-Sep-2020

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2020.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at https://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Saveontyres.co.uk Free SEO Report

Website Inpage Analysis for Saveontyres.co.uk

H1 Headings

1 :
  1. Mail order tyres at a budget to suit you

H2 Headings

2 :
  1. How Save On Tyres works
  2. Why choose Save On Tyres?

H3 Headings

5 :
  1. 1. Choose your Tyres
  2. 2. Delivered to your door
  3. 3. Enjoy your Savings
  4. 01392 203051
  5. [email protected]

H4 Headings

3 :
  1. Buy Tyres Online
  2. Tyre Manufacturers
  3. Help & Advice

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

62 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-179617410-1

Links - Internal

34:
  1. No text
    https://saveontyres.co.uk/
  2. Home
    https://saveontyres.co.uk/
  3. Car Tyres
    https://saveontyres.co.uk/car-tyres/
  4. Van Tyres
    https://saveontyres.co.uk/van-tyres/
  5. 4×4 Tyres
    https://saveontyres.co.uk/4x4-tyres/
  6. Winter Tyres
    https://saveontyres.co.uk/winter-tyres/
  7. About Us
    https://saveontyres.co.uk/about-us/
  8. Contact Us
    https://saveontyres.co.uk/contact-page/
  9. My Account
    https://saveontyres.co.uk/my-account/
  10. Cart0£0.00
    https://saveontyres.co.uk/shop/cart/
  11. Cart
    https://saveontyres.co.uk/shop/cart/
  12. No text
    https://saveontyres.co.uk/my-account/
  13. Cart0
    http://saveontyres.co.uk/
  14. No text
    https://saveontyres.co.uk/winter-tyres/
  15. 4x4 Tyres
    https://saveontyres.co.uk/4x4-tyres/
  16. Aoteli Tyres
    https://saveontyres.co.uk/aoteli-tyres/
  17. Gowind Tyres
    https://saveontyres.co.uk/gowind-tyres/
  18. Hifly Tyres
    https://saveontyres.co.uk/hifly-tyres/
  19. Jinyu Tyres
    https://saveontyres.co.uk/jinyu-tyres/
  20. Kpatos Tyres
    https://saveontyres.co.uk/kpatos-tyres/
  21. Marshal Tyres
    https://saveontyres.co.uk/marshal-tyres/
  22. Pirelli Tyres
    https://saveontyres.co.uk/pirelli-tyres/
  23. Powertrac Tyres
    https://saveontyres.co.uk/powertrac-tyres/
  24. Torque Tyres
    https://saveontyres.co.uk/torque-tyres/
  25. Tracmax Tyres
    https://saveontyres.co.uk/tracmax-tyres/
  26. Joyroad Tyres
    https://saveontyres.co.uk/joyroad-tyres/
  27. Yokohama Tyres
    https://saveontyres.co.uk/yokohama-tyres/
  28. Find my Tyre Size
    https://saveontyres.co.uk/find-the-size-of-tyre/
  29. Tyre Pressures
    https://saveontyres.co.uk/tyre-pressures/
  30. No text
    https://saveontyres.co.uk/find-the-size-of-tyre/
  31. Tyre Labelling Explained
    https://saveontyres.co.uk/tyre-icons-explained/
  32. Delivery info
    https://saveontyres.co.uk/delivery-information/
  33. Returns info
    https://saveontyres.co.uk/returns-information-2/
  34. Legal
    https://saveontyres.co.uk/legal/

Links - Internal (nofollow)

0:

Links - Outbound

3:
  1. No text
    https://twitter.com/saveontyressw
  2. No text
    https://www.instagram.com/save_on_tyres/
  3. No text
    https://www.facebook.com/Save-On-Tyres-102178297999067

Links - Outbound (nofollow)

0:

Keyword Cloud for Saveontyres.co.uk

savesourceopentablesans boldlocalopensansboldgreatfindnewreviewspantiwidgetdatalayoutid4datasetidlightbackground1strongsourcegoogletilargelogo imgmaxwidth150pxtiwidgetsourcefoursquarechoosesansfontstylenormalfontweight400fontdisplayswapsrclocalopen sans regularcsansfontstylenormalfontweight700fontdisplayswapsrclocalopen sanstyres onlinesansfontstylenormalfontweight700fontdisplayswapsrclocalopen200msverifiedregular localopensansregulartiheadertireviewitemsansfontstylenormalfontweight400fontdisplayswapsrclocalopenimportantpadding0pxsans bold localopensansboldcartyres wintersave on tyresbuywinter tyrescar tyrestyres van tyressourcetrustindexregularimportanttiwidgetdatalayoutid4datasetidlightbackgroundvartilargelogomarginbottom5pxtiwidgetmaxwidth479pxtiwidgetdatalayoutid4datasetidlightbackgroundsourcehotelstyres winter tyressourcebookingverified reviewtyres vangoodcustomer servicetyresimgmaxwidth150pxtiwidgetvan tyresboldtiratingtextsourceamazondaysansfontstylenormalfontweight400fontdisplayswapsrclocalopen sanstransparentwintersanstilargelogo20200214 verified reviewbold localopensansboldsourcecapterradeliveredtifootercopyrightlocalopensansregularcontacttireviewitemmsflex0 0customertyre sizesourcetripadvisorsourcearukeresoyousizesourcefacebookyourtiwidgetcontainerwepricetyretifooter100tiwidgetcar tyres vancontact usservicetireviewitem tirecommendationnew tyrestireviewitemmsflex0ustirecommendationmysourcetrustpilotsans regular localopensansregularsans regularsansfontstylenormalfontweight700fontdisplayswapsrclocalopen sans boldsourceyelpticontrolssourcebookatablestrongtiwidgetdatalayoutid4datasetidlightbackgroundvan0search2020021420200214 verifiedsourceairbnbonline

Longtail Keyword Density for Saveontyres.co.uk

KeywordsOccurences
sans regular localopensans-regular7
sansfont-stylenormalfont-weight400font-displayswapsrclocalopen sans regular7
sansfont-stylenormalfont-weight700font-displayswapsrclocalopen sans bold7
sans bold localopensans-bold7
car tyres van4
tyres van tyres4
tyres winter tyres4
save on tyres4
2020-02-14 verified review4
ti-large-logo imgmax-width150pxti-widget7
sansfont-stylenormalfont-weight400font-displayswapsrclocalopen sans7
bold localopensans-bold7
sans bold7
sansfont-stylenormalfont-weight700font-displayswapsrclocalopen sans7
regular localopensans-regular7
sans regular7
verified review7
tyres online4
tyres van4
2020-02-14 verified4
winter tyres4
tyres winter4
van tyres4
ti-review-item-ms-flex0 04
car tyres4
customer service3
new tyres3
tyre size3
contact us3
ti-review-item ti-recommendation3
tyres63
100ti-widget30
ti-large-logo16
ti-controls14
sans14
012
tyre12
importantti-widgetdata-layout-id4data-set-idlight-background10
ti-large-logomargin-bottom5pxti-widget10
source-facebook9
your8
localopensans-bold7
verified7
review7
ti-header7
ti-footer7
sansfont-stylenormalfont-weight400font-displayswapsrclocalopen7
regular7
localopensans-regular7
sansfont-stylenormalfont-weight700font-displayswapsrclocalopen7
bold7
service7
source-yelp7
source-google7
source-arukereso7
source-capterra7
source-bookatable7
source-foursquare7
source-opentable7
source-trustindex7
source-hotels7
ti-rating-text7
online7
source-amazon7
imgmax-width150pxti-widget7
source-booking7
source-airbnb7
source-trustpilot7
source-tripadvisor7
ti-widget-container6
car6
us6
you6
buy5
good5
my5
day5
size5
15
ti-review-item5
winter4
van4
price4
ti-review-item-ms-flex04
great4
200ms4
2020-02-144
new4
strongti-widgetdata-layout-id4data-set-idlight-background4
strong4
save4
search4
var4
find3
contact3
transparent3
we3
choose3
delivered3
customer3
spanti-widgetdata-layout-id4data-set-idlight-background3
ti-footer-copyright3
importantpadding0px3
ti-recommendation3
max-width479pxti-widgetdata-layout-id4data-set-idlight-background3
c3

Saveontyres.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Websites with Similar Names

Saveoaklandschools.org
saveoaklandschools - Oakland parents and teachers are sitting-in to fight for public education.saveoaklandschools | Oakland parents and teachers are sitting-in to fight for public education.
Saveoaklandsports.org
Agen Judi Online, Situs Poker Online, Bandar Domino QQ
Saveoanda.com
Saveoanda
Saveoceanicsharks.org
Save Oceanic Sharks (sos) - Sharks Must Survive (SOS)
Saveoceantreasures.com
Protect New England's Ocean Treasures - Home | Facebook
Saveoedical.com
saveoedical.com

Recently Updated Websites

Wallpapers27.com 2 seconds ago.Ivanovak.com 3 seconds ago.Facialexpressionsandmore.com 3 seconds ago.Ctn.org.br 3 seconds ago.Caupholstery.com 4 seconds ago.Meeraescorts.com 4 seconds ago.Misrahirealty.com 4 seconds ago.Brookfieldrp.com 4 seconds ago.Mobisecur.es 5 seconds ago.Biria.com 5 seconds ago.Temirgali.org 6 seconds ago.Bbvacompasspointsrewards.com 6 seconds ago.Radarlab.org 6 seconds ago.Red-deer.org 6 seconds ago.Primecoinsurance.com 7 seconds ago.Cloudblotter.com 7 seconds ago.13rules.nl 8 seconds ago.Thedeseretkid.com 9 seconds ago.Silbitsolutions.com 10 seconds ago.Kennedys.com.au 10 seconds ago.Montgomeryoh.org 10 seconds ago.Latitude64photos.com 10 seconds ago.Jurisnantes.com 10 seconds ago.Yhkj88.com 10 seconds ago.360degreeltd.com 11 seconds ago.Zork.online 11 seconds ago.Digghits.com 11 seconds ago.Yamaguchi-coffee.com 12 seconds ago.Bestserverssecure.info 12 seconds ago.Cakepeixun.com 12 seconds ago.