Levels Auto Sales - Private Party Pricing at a Retail Car Lot #LevelUP 1500 N Oracle RD Tucson AZ 85705

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Levels.Autos Levels Auto Sales Levels Check Price Levels Beating Anyone in U.S. Levels Tucson Arizona on Oracle Rd. Find Your Next Car At Levels!



Domain summary

Last updated
2021-06-13
Domain label
says
Domain extension
builders
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Says.builders registered?
A: Says.builders was registered 10 months, 3 days, 17 hours, 41 minutes, 58 seconds ago on Wednesday, February 3, 2021.
Q: When was the WHOIS for Says.builders last updated?
A: The WHOIS entry was last updated 10 months, 3 days, 17 hours, 41 minutes, 58 seconds ago on Wednesday, February 3, 2021.
Q: What are Says.builders's nameservers?
A: DNS for Says.builders is provided by the following nameservers:
  • ns22.domaincontrol.com
  • ns21.domaincontrol.com
Q: Who is the registrar for the Says.builders domain?
A: The domain has been registered at .
Q: What is the traffic rank for Says.builders?
A: Says.builders has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Says.builders each day?
A: Says.builders receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Says.builders resolve to?
A: Says.builders resolves to the IPv4 address 184.168.131.241.
Q: In what country are Says.builders servers located in?
A: Says.builders has servers located in the United States.
Q: What webserver software does Says.builders use?
A: Says.builders is powered by Microsoft-IIS/8.5 webserver.
Q: Who hosts Says.builders?
A: Says.builders is hosted by AS-26496-GO-DADDY-COM-LLC in United States.
Q: How much is Says.builders worth?
A: Says.builders has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Says.builders Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Says.builders Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Says.builders

H1 Headings

1 :
  1. We Love What We Do.We Want You To Love Your Next Vehicle.

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

100 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-167510271-1

Links - Internal

230:

Links - Internal (nofollow)

0:

Links - Outbound

51:

Links - Outbound (nofollow)

0:

Keyword Cloud for Says.builders

transformcontroltire pressure24255radiosatellite radiobluetooth connectionmp3moztransitionall 02s webkittransitionallbackground olineargradientrightright0174 0 34181webkitborderradius 30px borderradiuslumbar supportadjustabletextshadow noneimportantresponsiveslidwshows24255 5555 1744px 0pxrgba25510801rearshift transmissionpower windowscd242 55 55progiddximagetransformmicrosoftgradientvisibilityhiddenwidth100pxmedia only screenradiobluetoothconnectionmp3lineargradienttolumbar supportpower20pxmarginbottombackgroundfffclickborderbottomstyle solid bordertop999boxshadow 0 2pxrgba25510801 rgba25519801 background1s easeinouttransitionhidden000000controlsecuritybackgroundsizecoverimportant16 hwy0308 24255passengerbordertopstyle solidbodycssoverflowypressure monitorpowerwindowscd playertractionpressure monitordual shiftcentermozboxshadow insetborderbottomborder1pxsolid borderbottom noneshaderear windowcontrolcruise controlsecurity alarmolineargradientright0 1px rgba0boxshadow 0sound2px 5px rgba0radiomp3 playeraux inputkeylessbordertopsolid 00b2edoutlineborderbottom nonewidth32px174 0webkitborderradius 3px borderradiusopacity10pxplayeraux209 109128 27620935smoztransitionrgba0closeentrystability controlcruise controlbrake999importantboxshadowoutletrear window defoggerchildradiomp3 playerauxrgba0 0bordertopcolorplayertraction controlpower30px webkitborderradius18locksfront wheel drive6995getgpitem widthpressure monitordual2px 5px0308 24255 5555color5px 0000000px 6px 0px131z22202f3e3c2fsvg3ebackgroundsize26px 24pxbackgroundpositioncenterrgba1770003px borderradiuspadding0pxalarm systemheated frontwheel audioopacity03background276209 452096pxpositionrgba177001 rgba2434601 backgroundboxshadow02swebkittransitionall 02stransitionallpressure monitorpower windowstraction2135l145132c5154678557758551153controlsecurity alarm systemtirevehidcontrolwoodgrain trimsecurity alarmpositionabsolute2pxwebkitborderradius 2pxborderradiuswheelpressureengineconnectionmp3 playeraux inputkeylesssystembackup35s backgroundsize1px rgba0 0urldataimagesvgxmlcharsetutf83csvg20xmlns3d22http3a2f2fwwww3org2f20002fsvg2220xmlns3axlink3d22http3a2f2fwwww3org2f19992fxlink2220width3d222002220height3d22200223e3cpath20fill3d22rgba0000752220stroke3d22rgba14114114102220strokewidth3d2212220style3d22strokedasharray 1px2px 999mozboxshadow0 5pxtextaligncenter00b2edoutlinewebkittransitionall 02s transitionall0px2220d3d22m12 2135l145132c5154678557758551153else donothingshiftcursorpointerdrivemakeborderleftcolor1s easeinout borderdonothing19pxconnectionmp3 playerpremiumbottom 0controlsteering wheel0pxcontrolwoodgrainmonitordual shift transmissionpowerwebkitlineargradientleftsupportpower windowscdvehicle30pxcontrolpower outletrear window276209tradenissanofferappraise your tradedodge5px rgba0fontsize14px3px 2px 999mozboxshadow24pxdefoggerrear wheelfffdisplayblockcolorfffpressure monitorrear spoilerpower2135l145132c5154678557758551153 0308none borderleftcolorcontrolsecurity alarm systembrakecontrolsteering4windowstraction controlsteering wheel4pxcontrolbrake assisttire pressuretransmissionrear spoilerpowermonitordualb6b6b6boxshadow0px 2pxcontrolwoodgrain trimsecurityborder 1scontrolpower1px rgba00005letterspacing02px cursorpointerdrive6995get financedtest drivemake209 1091280 341815555 174 0textalign center mozborderradiussystembrake assisttirelancermozboxshadowentrystability controlcruise controlsecurityrgba2552552551 0rgba255255255065front seatsbrakesupportpowercamerakeyless startremotedisplaynoneimportantwidth100shift transmissionrear spoilerpowergpitem0 34181 4545209 308backgroundpositioncenter centertransmissionrearbordertopstyle solid borderbottom55 0 37834monitoradjustable driver lumbarhwycontrolsrear windowtransitionallsolidentrystability controlcruise controltireborderinset 0pxfrontinlineblockwidth 20pxheight02s webkittransitionallreturnwindowslideshowidelseentrystability controlcruiseoutletcargo shaderearpadding10pxaudio controlsrear windowcolor999gpitemlargecontainer12px 0pxinputkeyless entrystability controlcruisebackgroundpositioncentersupportdual shift transmissionpowerassisttire pressure monitordualborderboxboxsizingcontrolbrake0 55999mozboxshadow 0 2pxwheel audio controlsrear0 1pxofferappraiseonly screen999boxshadow 0driver24pxbackgroundpositioncenteroutletcargogtheadercontaineraddclassgtheadercontainerscrolled0 37834 686855wheel drive6995get financedtesttipsyarrowborderbottom1px solidlumbar supportadjustable passengerrgba0 0 0mccounterplayertraction controlpower outletrearshadereargpitemsmallcontainerdefoggerfront1px rgba0gtwidgetsmycarsiconheadercounterfilterinset 0 0outletcargo shaderear window35sotransitioneaseinouttransition37834 686855 1154l145solid bordertopyour tradenissanclearbothwidth100 height100seatcd0 1px rgba0000353px webkitborderradius 3px3pxborderradiusleft0playeraux inputkeylessalarm systembrake assisttirebordertop none borderleftcolorrightwebkitborderradius 30pxradiosatellite0px 0px 0pxpromisedonefunctioninlineblockborderleftcolor transparenttransparentbottom01sassisttire pressuremozborderradius 3px webkitborderradius109128 276209radiobluetooth connectionmp3 playerpremiumrgba0000colorc5c5c5important textshadowoptoffsetassisttire pressure monitorpowernone02stransitionalldoor locksfront wheeltextmoztransitionall 02sdriver lumbar supportdualmaxwidthcontrolsrear12pxleft3px 2px 999boxshadowselectfinancedtest drivemakeeaseinoutdisplayinlineblockinlineblockwidth 20pxheight 20pxmarginbottomfontweight400margin0pximportanttipsyarrow top8px6counterrors 0radiosatellite radiobluetooth6px 0pxpxbackground lineargradienttononewebkitboxsizing borderboxmozboxsizing borderboxboxsizingmenulink802s webkittransitionall 02smedia onlygcoltorowengine startleatherlocksfront wheel12pxcolorfffimportantmozborderradiusauto0renderdim13 hwyyour trademitsubishi lancerpositionrelativelumbar supportdual shiftbackground 1s easeinout02swebkittransitionalltradedodgecenter mozborderradiusstartremotesystemaux inputkeylessgtvehmenuoptionrgba0961570 rgba0961571verticalalign topnbsp2pxborderradiustextalign999importantboxshadow 0 2pxcamerakeyless startremote engine1655 242 55transmissionpower windowscd2rgba2552552551controlspowerabsolutecamerakeyless35swebkittransition1s easeinoutotransitionsystemheated front686855 1154l145 131z22202f3e3c2fsvg3ebackgroundsize26px2px 999importantboxshadowtransmissionpowersupportpower windowscd playertraction2px 999importantmozboxshadow 0borderbottom1pxfontsize15pxclick function0 0wheel audio controlspowerplayertraction0 topcontrolcruise controlwoodgrain trimsecurityspoilerpower windowscd3px 2px2pxborderradius 2pxwebkitappearancerover3pxwebkitborderradius 3pxborderradius2135l145132c5154678557758551153 0308 24255monitordual shift308 0 55trademitsubishi lancerdisplayblockimportant width100importantcontrolcruise controlbrakeinlineblockwidthinsetnoneimportant fontstyleitalicboxshadow insetdoorverticalalign0 37834rgba25510800inputkeylessdriver lumbar supportpower999importantmozboxshadow2px 999importantboxshadow 0bottomsystembrakergba177001 rgba2434601borderbottomstylergba0961571 rgba0171250110px 14pxdivb6b6b6boxshadow0pxfadeinvarpromisedonefunctionalarm systemheatedrgba25519801window defoggerfront wheel34mp310svgsafetypadding15pxmediargba2434601displayinlineblockimportantlevels auto2px 999boxshadow 045 209lumbarmozborderradius 3px1s easeinoutmoztransitionboxshadow inset 0pxsafety rear20pxheight 20pxmarginbottom5555 174nonewebkitboxsizingradiomp3opacity 1scursordefaultlumbar supportpower windowscdcontrolcruise controlwoodgrain0 5px 000000monitorpower windowscddisplay inlineblockwidthreferbutrgba25510801 rgba25519801drive6995getvarwebkittransitionbordertopstyleeaseinout border 1sgpslidermessagecontainercenteralarm systembrakeoverflow hidden2px 999importantmozboxshadow6px 0px 0pxborder2px0 var3px 2px 999importantmozboxshadowonlyscale104solid bordertop nonedisplaynone1s easeinoutmstransition1px 0px2220d3d22m12 2135l145132c515467855775855115330px webkitborderradius 30px24 hwyrearsatellite276209 45209 308monitorpower windowscd playertraction15playerpremium sound systemauxhwy 34mp3divfirstchildtextshadow noneimportant fontstyleitalic1s easeinout37834 686855displayblockimportantcontrolsteering wheel audiomycarsmannotdialogdialogopenborderbottomstyle solid200pxcontrolcruise controltire pressureborder1px solid1154l145 131z22202f3e3c2fsvg3ebackgroundsize26px 24pxbackgroundpositioncenterrgba25510800 rgba25510801 rgba25519801startremote engine999mozboxshadow 0opacity1importantfontsizemonitorrearsystemaux inputkeyless entrystabilitywindow defoggerrear wheelstartremote engine startleatherfunction686855 1154l145ddmoptions2centerimportantmozborderradiusrgba25510800 rgba25510801img2px 999boxshadowcamerabluetooth connectionmp3monitoradjustable drivercolorrgba230179521rgba01712501 background02s transitionallscreen and maxwidthofferappraise yourcontrolcruise controlsecurityopacity 35snbspnbsp2px 999mozboxshadow 0you cangiconrgba01712501windowaudio controlspower outletrearnone borderleftcolor transparentseatsbrake assisttire pressuremozborderradius 30pxpadding022pxbackgroundpositioncenterinset 0px 0pxplayerpremium soundmozboxshadow inset 0playertraction controlsteering wheelassisttire pressure monitoradjustableplayertraction controlsteeringplayerpremiumcanletterspacing02pxborderboxmozboxsizing borderboxboxsizingyour tradechevroletplayeraux inputkeyless entrystabilitydoor locksfrontcursor1 fadeinvarpromisedonefunctionlocksfrontcontrolsecurity alarmcounterrorsborderbottom none borderleftcolor999importantmozboxshadow 0passenger lumbaryour tradedodgetotalofinputsfinishedinset 0solid b6b6b6boxshadow0px 2px5pxif datawindowstractioninputkeyless entrystabilityfront seatsbrake assisttirespoilerpowertransmissionrear spoilerpower windowscdsystemtire6pxwebkitborderradiusfunctiondatayourwindowscd playertraction controlpoweropacity 35s backgroundsizeidurldataimagesvgxmlcharsetutf83csvg20xmlns3d22http3a2f2fwwww3org2f20002fsvg2220xmlns3axlink3d22http3a2f2fwwww3org2f19992fxlink2220width3d222002220height3d22200223e3cpath20fill3d22rgba0000752220stroke3d22rgba14114114102220strokewidth3d2212220style3d22strokedasharray0 leftborderbottomcolor3pxsupportadjustable passenger999boxshadow2pxwebkitborderradiuswindow defoggerrearbackgroundsizeoutletrear windowtextdecorationverticalaligntopelse if999mozboxshadowfbqtrackframeheightalarm systemtire pressureradiobluetooth connectionmp3 playerauxrgba25519801 background0px 0pxtransmissionpower windowscd playertractiontextalign centercamerabluetoothonelumbar supportdual0 0 1px20px0px 6px0 2px 3pxheightsupportdualcolorc5c5c5importantallwheel drive6995getrgba177000 rgba177001 rgba2434601shift transmissionreartipsyinnersystemheateddisplaytabletradechevroletborderboxmozboxsizingwindowscd playertraction controlsteeringnbsp nbspbackgroundposition17alarm systemtiredisplaytablecellsendlikestatustrue3offerappraise your tradechevrolet15px34181 45spoilerpower windowscd playertractioneaseinoutmstransitionsolid rgba23017952145209top0falseaudio controlspower1pxwebkittransitionallsupportdual shiftbackgroundimage urldataimagesvgxmlcharsetutf83csvg20xmlns3d22http3a2f2fwwww3org2f20002fsvg2220xmlns3axlink3d22http3a2f2fwwww3org2f19992fxlink2220width3d222002220height3d22200223e3cpath20fill3d22rgba0000752220stroke3d22rgba14114114102220strokewidth3d2212220style3d22strokedasharray 1pxrgba2434601 background0px2220d3d22m12 2135l145132c5154678557758551153 0308trimsecurity alarmcontrolpower outletrearwindowscd1154l145 131z22202f3e3c2fsvg3ebackgroundsize26px14px20 hwycontrolcruise controlbrake assisttirebackgroundrepeatnorepeatrear door locksfront13position absolutemoztransitionallentrystability45 209 1091282px 3pxwindow defoggerfrontconnectionmp3 playerauxlazyloadimg5555screen000rgba177001borderrightcolor transparentpadding 01monitorpower windowstraction controlsteeringseatsbrake assisttire1px rgba000035window defoggerchild safety37834totalofinputs0px2220d3d22m1218px2pxwebkitborderradius 2pxborderradius 2pxwebkitappearancesolid b6b6b6boxshadow0pxcamerahdrgba0961571 rgba01712501 background109128outletreareaseinout borderdefoggerchild safetyentrystability controlcruise controlwoodgrainlineargradientto right0 0 5px10px 0pxbordertop nonemozborderradius 30px webkitborderradius999importantmozboxshadow 0 2pxborderradiusdrive6995get financedtestofferappraise your trademitsubishirgba0961570pressure monitoradjustable5displayinlineblock verticalaligntopalarmtop 0controltire45209 308 030px borderradius0 2pxcontrolspower outletrearconnectionmp3 playerpremium sound5px rgba0 0borderleftcolor transparent borderrightcolorrgba0961570 rgba0961571 rgba017125011px 0px2220d3d22m12display inlineblockdefoggerchild safety rearstartleather109128 276209 452092pxgpslidermessagecontainerright34181 45 2093px webkitborderradiussound systemaux inputkeyless686855audio controlsrearassisttire1154l1450 1px rgba000052px 3px 2pxrgba177000 rgba17700120pxheight0 55 24255 55 0margin00rgba255255255065audiosound systemaux35sdriver lumbar supportadjustablerear doorlineheightheight100controlspower outletrear windowstartbluetoothgtdskmenu2pxwebkitappearancecontrolbrake assisttirewebkittransitionall 02s6pxmozborderradiussystemtire pressurergba00005defoggerfront wheeloverflowsupportadjustablelevelssolid borderbottomrowsystemheated front seatsbraketransparent borderrightcolor3px 2px 999importantboxshadoweaseinoutmoztransitionrgba0961571verticalalignmiddle55 0fontsize12pxsystemauxcontrolcruise controltiretextshadowradiobluetooth connectionmp3function vardisplayyour trademitsubishitop25 hwyrgba255255255025dataofferappraise your tradenissantelematicsbackupyou999importantboxshadow 0tipsyarrow bottomwindowwidthshift transmissionpoweriftrademitsubishiwindowmaxframeheight0rgba255255255065 100systembrake assisttire pressurebackground lineargradientto rightfinancedtest308 055 242webkitborderradiusmozlineargradientright7pricesdrivemake an offerappraise6pxmozborderradius 6pxwebkitborderradiuswindowstraction controlsteeringdefoggerchildmonitorpowerdisplay inlineblockwidth 20pxheightwindow defoggerchildleft0 right0cartypelrgimgmonitoradjustablecamerabluetooth connectionmp3 playeraux18 hwyheightautononeimportantborderrightcolorbackgroundimage urldataimagesvgxmlcharsetutf83csvg20xmlns3d22http3a2f2fwwww3org2f20002fsvg2220xmlns3axlink3d22http3a2f2fwwww3org2f19992fxlink2220width3d222002220height3d22200223e3cpath20fill3d22rgba0000752220stroke3d22rgba14114114102220strokewidth3d2212220style3d22strokedasharray24255 5555div displayinlineblockrgba000035gtsvgiconwebkitborderradius 3px02ssupportadjustable passenger lumbar3pxwebkitborderradiustransparent borderrightcolor transparentgtheadercontainerheightcontrolcruisebackground webkitlineargradientleft0308nonewebkitboxsizing borderboxmozboxsizingmonitorpower windowstractionbackgroundimageloopsliderthisitemsdelayvarfadeinvardefoggerrearrgba230179521pressure monitoradjustable driverbackground 1sgpitemproplinevehoptions025s11131z22202f3e3c2fsvg3ebackgroundsize26pxwidth35smstransition9contenttrimsecuritypressure monitorpower windowscdtipsyarrow bottom 0drivenavigationcinputseachfunctionborder2px solidfontweightboldheight42pxlineheight42pxpadding0pxbackground mozlineargradientrightcolorc5c5c5important textshadow noneimportantmonitorrear spoilerpowerseatsbrakefontstyleitalic55 55easeinoutotransition14paddingwheel drivenavigationdriver lumbarsafety rear doorpressure monitorrear242 55controlsrear window defoggerchildrgba2552552551 0rgba255255255065 10012width100important

Longtail Keyword Density for Says.builders

KeywordsOccurences
drivemake an offerappraise41
2px 3px -2px27
0 2px 3px27
inputkeyless entrystability controlcruise27
playeraux inputkeyless entrystability25
controlsteering wheel audio22
window defoggerchild safety18
defoggerchild safety rear18
safety rear door18
connectionmp3 playeraux inputkeyless17
entrystability controlcruise controlsecurity16
controlcruise controlsecurity alarm16
rgba0 0 015
pressure monitoradjustable driver15
monitoradjustable driver lumbar15
alarm systembrake assisttire13
door locksfront wheel13
rear door locksfront13
systembrake assisttire pressure13
windowscd playertraction controlsteering13
playertraction controlsteering wheel13
radiobluetooth connectionmp3 playeraux12
assisttire pressure monitoradjustable12
controlsecurity alarm systembrake12
wheel audio controlspower12
outletrear window defoggerchild11
ease-in-out border 1s10
inset 0 010
audio controlspower outletrear10
controlspower outletrear window10
background 1s ease-in-out10
1s ease-in-out border10
transmissionpower windowscd playertraction9
0 0 1px9
audio controlsrear window9
wheel audio controlsrear9
assisttire pressure monitorpower7
media only screen7
windowstraction controlsteering wheel7
shift transmissionpower windowscd7
controlbrake assisttire pressure7
1px rgba0 07
screen and max-width7
6px 0px 0px6
lumbar supportdual shift6
entrystability controlcruise controlwoodgrain6
0 1px rgba06
seatsbrake assisttire pressure6
front seatsbrake assisttire6
rgba0961570 rgba0961571 rgba017125016
controlwoodgrain trimsecurity alarm6
rgba0961571 rgba01712501 background6
background-image urldataimagesvgxmlcharsetutf83csvg20xmlns3d22http3a2f2fwwww3org2f20002fsvg2220xmlns3axlink3d22http3a2f2fwwww3org2f19992fxlink2220width3d222002220height3d22200223e3cpath20fill3d22rgba0000752220stroke3d22rgba14114114102220stroke-width3d2212220style3d22stroke-dasharray 1px6
offerappraise your tradenissan6
radiosatellite radiobluetooth connectionmp36
controlsrear window defoggerchild6
none border-left-color transparent6
monitorpower windowscd playertraction6
pressure monitorpower windowscd6
border-left-color transparent border-right-color6
playerpremium sound systemaux5
sound systemaux inputkeyless5
systemaux inputkeyless entrystability5
drive6995get financedtest drivemake5
offerappraise your trademitsubishi5
999-moz-box-shadow 0 2px5
3px -2px 999-moz-box-shadow5
wheel drive6995get financedtest5
offerappraise your tradedodge5
3px -2px 999box-shadow5
-2px 999box-shadow 05
999box-shadow 0 2px5
-2px 999-moz-box-shadow 05
pressure monitordual shift5
opacity 35s background-size5
driver lumbar supportpower5
offerappraise your tradechevrolet5
controlcruise controlwoodgrain trimsecurity5
window defoggerrear wheel5
radiobluetooth connectionmp3 playerpremium4
connectionmp3 playerpremium sound4
controlcruise controltire pressure4
driver lumbar supportdual4
window defoggerfront wheel4
alarm systemheated front4
camerakeyless startremote engine4
alarm systemtire pressure4
spoilerpower windowscd playertraction4
assisttire pressure monitordual4
windowscd playertraction controlpower4
pressure monitorpower windowstraction4
playertraction controlpower outletrear4
controlpower outletrear window4
radiomp3 playeraux inputkeyless4
entrystability controlcruise controltire4
-webkit-border-radius 30px border-radius4
3px -webkit-border-radius 3px4
999important-moz-box-shadow 0 2px4
-2px 999importantbox-shadow 04
999importantbox-shadow 0 2px4
-2px 999important-moz-box-shadow 04
3px -2px 999important-moz-box-shadow4
transparent border-right-color transparent4
rgba2552552551 0rgba255255255065 1004
-webkit-transitionall 02s transitionall4
02s -webkit-transitionall 02s4
-moz-border-radius 3px -webkit-border-radius4
-moz-transitionall 02s -webkit-transitionall4
background linear-gradientto right4
text-shadow noneimportant font-styleitalic4
colorc5c5c5important text-shadow noneimportant4
display inline-blockwidth 20pxheight4
inline-blockwidth 20pxheight 20pxmargin-bottom4
-moz-border-radius 30px -webkit-border-radius4
30px -webkit-border-radius 30px4
3px -2px 999importantbox-shadow4
entrystability controlcruise controlbrake3
camerabluetooth connectionmp3 playeraux3
276-209 45-209 3083
0 55 2423
45-209 308 03
308 0 553
109-128 276-209 45-2093
55 242 553
242 55 553
55 55 03
55 0 378-343
0 378-34 686-8553
378-34 686-855 1154l-1453
controlcruise controlbrake assisttire3
34181 45 2093
controlsecurity alarm systemtire3
242-55 55-55 1743
1px 0px2220d3d22m12 2135l-145-132c-515-467-855-775-855-11533
0px2220d3d22m12 2135l-145-132c-515-467-855-775-855-1153 0-3083
locksfront wheel drive6995get3
your trademitsubishi lancer3
monitorpower windowstraction controlsteering3
2135l-145-132c-515-467-855-775-855-1153 0-308 242-553
0-308 242-55 55-553
supportpower windowscd playertraction3
209 109-128 276-2093
lumbar supportpower windowscd3
55-55 174 03
174 0 341813
0 34181 453
686-855 1154l-145 131z22202f3e3c2fsvg3ebackground-size26px3
outletcargo shaderear window3
45 209 109-1283
pressure monitorrear spoilerpower3
0 1px rgba000053
1154l-145 131z22202f3e3c2fsvg3ebackground-size26px 24pxbackground-positioncenter3
inset 0px 0px3
-webkit-border-radius 3px border-radius3
-moz-box-shadow inset 03
box-shadow inset 0px3
supportadjustable passenger lumbar3
lumbar supportadjustable passenger3
driver lumbar supportadjustable3
0px 6px 0px3
supportdual shift transmissionpower3
text-align center -moz-border-radius3
rgba25510800 rgba25510801 rgba255198013
startremote engine startleather3
rgba25510801 rgba25519801 background3
rgba177000 rgba177001 rgba24346013
rgba177001 rgba2434601 background3
systemheated front seatsbrake3
5px rgba0 03
0px 0px 0px3
0 0 5px3
solid b6b6b6box-shadow0px 2px3
2px-webkit-border-radius 2pxborder-radius 2px-webkit-appearance3
none-webkit-box-sizing border-box-moz-box-sizing border-boxbox-sizing3
transmissionrear spoilerpower windowscd3
shift transmissionrear spoilerpower3
0 1px rgba0000353
0 5px 0000003
2px 5px rgba03
border-bottom-style solid border-top3
solid border-top none3
border-top none border-left-color3
tipsy-arrow bottom 03
border-top-style solid border-bottom3
solid border-bottom none3
border-bottom none border-left-color3
monitordual shift transmissionpower3
offerappraise your41
financedtest drivemake40
0 034
entrystability controlcruise32
inputkeyless entrystability31
0 2px28
2px 3px27
3px -2px27
assisttire pressure26
playeraux inputkeyless25
windowscd playertraction23
controlsteering wheel22
wheel audio22
rear door18
window defoggerchild18
connectionmp3 playeraux18
controlsecurity alarm18
defoggerchild safety18
safety rear18
controlcruise controlsecurity16
radiobluetooth connectionmp316
outletrear window15
pressure monitoradjustable15
monitoradjustable driver15
rgba0 015
0px 0px15
driver lumbar15
alarm systembrake14
border1px solid14
playertraction controlsteering13
locksfront wheel13
door locksfront13
systembrake assisttire13
audio controlspower12
0 1px12
only screen11
inset 011
ease-in-out border10
1s ease-in-out10
background 1s10
controlspower outletrear10
border 1s10
opacity 1s10
pressure monitorpower10
audio controlsrear9
controlsrear window9
transmissionpower windowscd9
rgba0961570 rgba09615718
shift transmissionpower8
1px rgba07
controlbrake assisttire7
2px-webkit-border-radius 2pxborder-radius7
windowstraction controlsteering7
media only7
border-bottom1px solid7
controlcruise controlwoodgrain6
your tradenissan6
border-left-color transparent6
none border-left-color6
transparent border-right-color6
spoilerpower windowscd6
supportdual shift6
lumbar supportdual6
radiosatellite radiobluetooth6
controlwoodgrain trimsecurity6
gp-item width6
rgba0961571 rgba017125016
seatsbrake assisttire6
front seatsbrake6
trimsecurity alarm6
monitorpower windowscd6
background-image urldataimagesvgxmlcharsetutf83csvg20xmlns3d22http3a2f2fwwww3org2f20002fsvg2220xmlns3axlink3d22http3a2f2fwwww3org2f19992fxlink2220width3d222002220height3d22200223e3cpath20fill3d22rgba0000752220stroke3d22rgba14114114102220stroke-width3d2212220style3d22stroke-dasharray6
urldataimagesvgxmlcharsetutf83csvg20xmlns3d22http3a2f2fwwww3org2f20002fsvg2220xmlns3axlink3d22http3a2f2fwwww3org2f19992fxlink2220width3d222002220height3d22200223e3cpath20fill3d22rgba0000752220stroke3d22rgba14114114102220stroke-width3d2212220style3d22stroke-dasharray 1px6
6px 0px6
background linear-gradientto6
rgba01712501 background6
padding 06
your tradechevrolet5
defoggerrear wheel5
lumbar supportpower5
999box-shadow 05
24 hwy5
window defoggerrear5
your trademitsubishi5
20 hwy5
opacity 35s5
shaderear window5
function var5
35s background-size5
drive6995get financedtest5
playerpremium sound5
sound systemaux5
0 5px5
systemaux inputkeyless5
wheel drive6995get5
your tradedodge5
startremote engine5
-2px 999-moz-box-shadow5
text-align center5
999-moz-box-shadow 05
-2px 999box-shadow5
monitordual shift5
pressure monitordual5
0 var5
linear-gradientto right4
background -moz-linear-gradientright4
background -o-linear-gradientright4
connectionmp3 playerpremium4
rgba177000 rgba1770014
if data4
monitorpower windowstraction4
alarm systemheated4
display inline-blockwidth4
inline-blockwidth 20pxheight4
20pxheight 20pxmargin-bottom4
-moz-border-radius 30px4
counterrors 04
click function4
30px -webkit-border-radius4
-webkit-border-radius 30px4
30px border-radius4
border2px solid4
1 fadeinvarpromisedonefunction4
camerakeyless startremote4
radiomp3 playeraux4
background-positioncenter center4
0rgba255255255065 1004
rgba25510800 rgba255108014
1s ease-in-outtransition4
window defoggerfront4
systemtire pressure4
alarm systemtire4
1s ease-in-out-ms-transition4
background -webkit-linear-gradientleft4
1s ease-in-out-o-transition4
border-right-color transparent4
colorc5c5c5important text-shadow4
1s ease-in-out-moz-transition4
controlcruise controltire4
-webkit-border-radius 3px4
text-shadow noneimportant4
noneimportant font-styleitalic4
3px -webkit-border-radius4
-moz-border-radius 3px4
controltire pressure4
defoggerfront wheel4
-moz-transitionall 02s4
box-shadow inset4
02s -webkit-transitionall4
overflow hidden4
25 hwy4
display inline-block4
div displayinline-block4
rgba2552552551 0rgba2552552550654
3px-webkit-border-radius 3pxborder-radius4
999importantbox-shadow 04
systemheated front4
-2px 999importantbox-shadow4
999important-moz-box-shadow 04
-2px 999important-moz-box-shadow4
controlpower outletrear4
playertraction controlpower4
02s transitionall4
-webkit-transitionall 02s4
solid rgba2301795214
camerabluetooth connectionmp33
hwy 34mp33
trademitsubishi lancer3
shift transmissionrear3
monitorrear spoilerpower3
pressure monitorrear3
lumbar supportadjustable3
supportadjustable passenger3
passenger lumbar3
16 hwy3
controlcruise controlbrake3
transmissionrear spoilerpower3
13 hwy3
outletcargo shaderear3
supportpower windowscd3
displayblockimportant width100important3
rgba25519801 background3
engine startleather3
4px 0px3
55 03
0 378-343
378-34 686-8553
686-855 1154l-1453
1154l-145 131z22202f3e3c2fsvg3ebackground-size26px3
131z22202f3e3c2fsvg3ebackground-size26px 24pxbackground-positioncenter3
10px 0px3
242 553
solid b6b6b6box-shadow0px3
b6b6b6box-shadow0px 2px3
2pxborder-radius 2px-webkit-appearance3
none-webkit-box-sizing border-box-moz-box-sizing3
border-box-moz-box-sizing border-boxbox-sizing3
position absolute3
box-shadow 03
55 553
55 2423
tipsy-arrow top3
174 03
02s-webkit-transitionall 02stransitionall3
1px 0px2220d3d22m123
0px2220d3d22m12 2135l-145-132c-515-467-855-775-855-11533
2135l-145-132c-515-467-855-775-855-1153 0-3083
0-308 242-553
242-55 55-553
55-55 1743
0 341813
0 553
34181 453
45 2093
209 109-1283
109-128 276-2093
276-209 45-2093
45-209 3083
308 03
5px 0000003
border-bottom-style solid3
wheel drivenavigation3
rgba2434601 background3
displayinline-block vertical-aligntop3
vertical-align top3
10px 14px3
center -moz-border-radius3
rgba25510801 rgba255198013
rgba177001 rgba24346013
6px-moz-border-radius 6px-webkit-border-radius3
0px 6px3
1px rgba0000353
1px rgba000053
else if3
else donothing3
levels auto3
nbsp nbsp3
18 hwy3
width100 height1003
inset 0px3
solid border-top3
border-bottom none3
border-top none3
top 03
0 left3
tipsy-arrow bottom3
bottom 03
border-top-style solid3
solid border-bottom3
0 top3
12px 0px3
solid 00b2edoutline3
2px 5px3
5px rgba03
left0 right03
letter-spacing02px cursorpointer3
3px border-radius3
-moz-box-shadow inset3
you can3
0161
solid56
wheel52
background50
0px45
your43
offerappraise41
drivemake41
hwy41
financedtest40
3px39
2px39
entrystability36
pressure36
var36
controlcruise32
window32
inputkeyless31
if31
1s30
playeraux28
-2px27
1px26
width26
assisttire26
windowscd25
opacity25
displayinline-block24
alarm24
playertraction23
audio22
controlsteering22
connectionmp322
function22
width10020
controlsecurity18
safety18
door18
all18
lumbar18
rear18
defoggerchild18
radiobluetooth16
driver16
false16
rgba016
5px16
30px16
display16
monitoradjustable15
else15
outletrear15
10px15
box-shadow14
inset14
none14
transparent14
border14
border1px14
systembrake14
true13
shift13
border-radius13
only13
locksfront13
padding012
div12
controlspower12
top12
4px12
background-position12
112
-webkit-border-radius12
background-image12
screen11
12px11
-moz-border-radius11
auto11
211
monitorpower10
ease-in-out10
transmissionpower10
max-width10
02s10
center10
6px9
right9
img9
left9
controlsrear9
tipsy-arrow9
39
noneimportant9
front8
windowstraction8
padding8
width100important8
rgba09615708
height8
rgba09615718
gp-item-small-container8
right08
gp-item7
spoilerpower7
camerakeyless7
controlwoodgrain7
2px-webkit-border-radius7
2pxborder-radius7
displayblock7
border-right-color7
border-left-color7
border-bottom1px7
media7
radiosatellite7
18px7
hidden7
positionabsolute7
controlbrake7
15px7
position7
gp-item-large-container6
margin06
positionrelative6
cursor6
seatsbrake6
background-size6
urldataimagesvgxmlcharsetutf83csvg20xmlns3d22http3a2f2fwwww3org2f20002fsvg2220xmlns3axlink3d22http3a2f2fwwww3org2f19992fxlink2220width3d222002220height3d22200223e3cpath20fill3d22rgba0000752220stroke3d22rgba14114114102220stroke-width3d2212220style3d22stroke-dasharray6
totalofinputs6
22pxbackground-positioncenter6
transitionall6
rgba017125016
bottom06
sound6
opacity1important6
text6
data6
counterrors6
totalofinputsfinished6
linear-gradientto6
supportdual6
200px6
displaynone6
text-align6
controlpower6
line-height6
0006
tradenissan6
color6
46
bottom6
trimsecurity6
background-sizecoverimportant6
35s5
displayblockimportant5
fadeinvarpromisedonefunction5
displaynoneimportant5
px5
trademitsubishi5
55
gt-widgets-mycars-icon-header-counter5
shaderear5
content5
drive6995get5
gp-item-prop-line-vehoptions5
65
defoggerrear5
rover5
monitordual5
you5
background-positioncenter5
systemback-up5
left05
playerpremium5
supportpower5
tradechevrolet5
systemaux5
transform5
tradedodge5
startremote5
engine5
radiomp35
height1005
nbspnbsp5
referbut5
rgba2301795215
rgba25525525515
-moz-box-shadow5
75
8px5
text-decoration5
999box-shadow5
85
font-size15px5
999-moz-box-shadow5
windowslideshowid4
20pxheight4
promisedonefunction4
padding15px4
cursorpointer4
999important-moz-box-shadow4
border2px4
cartypelrgimg4
20pxmargin-bottom4
999importantbox-shadow4
ease-in-out-o-transition4
font-styleitalic4
padding10px4
025s4
ease-in-outtransition4
text-shadow4
ease-in-out-ms-transition4
vehicle4
3pxborder-radius4
3px-webkit-border-radius4
colorfff4
font-size4
nbsp4
passenger4
-moz-transitionall4
displaytable-cell4
ease-in-out-moz-transition4
systemheated4
bodycssoverflow-y4
-5px4
cinputseachfunction4
-webkit-transitionall4
click4
id4
inline-blockwidth4
controltire4
24px4
-o-linear-gradientright4
inline-block4
cursordefault4
vertical-align4
rgba000054
colorc5c5c5important4
row4
overflow4
filter4
backgroundfff4
-webkit-linear-gradientleft4
rgba255108004
divfirst-child4
rgba255108014
defoggerfront4
gt-dsk-menu4
-moz-linear-gradientright4
color9994
rgba1770004
35s-ms-transition4
systemtire4
35s-moz-transition4
35s-webkit-transition4
padding0px4
0rgba2552552550654
35s-o-transition4
rgba1770014
border-bottom3
border-box-moz-box-sizing3
border-top-style3
one3
can3
startleather3
2px-webkit-appearance3
none-webkit-box-sizing3
seatcd3
00b2edoutline3
rearsatellite3
supportadjustable3
-webkit-transition3
lancer3
gt-svgicon3
gicon3
02stransitionall3
34mp33
20px3
02s-webkit-transitionall3
startbluetooth3
b6b6b6box-shadow0px3
margin0pximportant3
camerabluetooth3
displayinline-blockimportant3
tipsy-inner3
centerimportant3
absolute3
monitorrear3
93
fff3
0000003
transmissionrear3
103
g-coltorow3
background-repeatno-repeat3
select3
border-bottom-color3
telematicsback-up3
border-top-color3
gp-slider-message-container-right3
gp-slider-message-container-center3
outletcargo3
border-boxbox-sizing3
border-bottom-style3
camerahd3
border-top3
12pxcolorfffimportant-moz-border-radius3
displaytable3
svg3
276-2093
6px-webkit-border-radius3
heightauto3
19px3
text-aligncenter3
rgba0000353
45-2093
109-1283
113
optoffset3
responsiveslidwshows3
frameheight3
windowmaxframeheight3
letter-spacing02px3
renderdim3
6px-moz-border-radius3
rgba24346013
gt-header-containeraddclassgt-header-container-scrolled3
scale1043
ddm-options-23
menulink3
686-8553
vertical-aligntop3
1154l-1453
131z22202f3e3c2fsvg3ebackground-size26px3
rgba00003
123
font-size14px3
14px3
width100px3
colorrgba2301795213
rgba255198013
font-size12px3
378-343
windowwidth3
133
rgba2552552550253
drivenavigation3
prices3
55-553
font-weightboldheight42pxline-height42pxpadding0px3
143
242-553
0-3083
vertical-alignmiddle3
lazyloadimg3
2135l-145-132c-515-467-855-775-855-11533
0px2220d3d22m123
font-weight4003
top03
width32px3
gt-veh-menu-option3
progiddximagetransformmicrosoftgradient3
levels3
return3
donothing3
153
gt-header-containerheight3
loopsliderthisitemsdelayvarfadeinvar3
opacity033
mycarsmannotdialogdialogopen3
clearboth3
163
visibilityhidden3
sendlikestatus3
24pxbackground-positioncenter3
functiondata3
173
close3
fbqtrack3
vehid3
mccounter3
183

Who hosts Says.builders?

Says.builders Hosting Provider Information

Hosted IP Address:184.168.131.241
Hosted Hostname:ip-184-168-131-241.ip.secureserver.net
Service Provider:AS-26496-GO-DADDY-COM-LLC
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:Microsoft-IIS/8.5

Is "AS-26496-GO-DADDY-COM-LLC" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
18.1104%
GOOGLE
13.7558%
AS-26496-GO-DADDY-COM-LLC
3.6367%
NAMECHEAP-NET
3.0541%
AMAZON-AES
2.2094%
GoDaddy.com, LLC
2.0363%
UNIFIEDLAYER-AS-1
1.9078%
Fara Negar Pardaz Khuzestan
1.5654%
CONFLUENCE-NETWORK-INC
1.4231%
1&1 Internet AG
1.3177%

HTTP Header Analysis for Says.builders

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Content-Type: text/html; charset=UTF-8
Server: Microsoft-IIS/8.5
X-Powered-By: ASP.NET
Date: Wed, 03 Feb 2021 16:23:39 GMT
Content-Length: 253540

Says.builders Domain Nameserver Information

HostIP AddressCountry
ns22.domaincontrol.com 173.201.68.11
ns21.domaincontrol.com 97.74.100.11


Need to find out who hosts Says.builders?


Domain Registration (WhoIs) information for Says.builders

 Domain Name: says.builders
Registry Domain ID: e5562196f675464297b28603d800a730-DONUTS
Registrar WHOIS Server: whois.godaddy.com/
Registrar URL: http://www.godaddy.com/domains/search.aspx?ci=8990
Updated Date: 2020-07-10T21:06:06Z
Creation Date: 2020-07-05T21:05:07Z
Registry Expiry Date: 2021-07-05T21:05:07Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registry Registrant ID: REDACTED FOR PRIVACY
Registrant Name: REDACTED FOR PRIVACY
Registrant Organization:
Registrant Street: REDACTED FOR PRIVACY
Registrant City: REDACTED FOR PRIVACY
Registrant State/Province: Arizona
Registrant Postal Code: REDACTED FOR PRIVACY
Registrant Country: US
Registrant Phone: REDACTED FOR PRIVACY
Registrant Phone Ext: REDACTED FOR PRIVACY
Registrant Fax: REDACTED FOR PRIVACY
Registrant Fax Ext: REDACTED FOR PRIVACY
Registrant Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Admin ID: REDACTED FOR PRIVACY
Admin Name: REDACTED FOR PRIVACY
Admin Organization: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin City: REDACTED FOR PRIVACY
Admin State/Province: REDACTED FOR PRIVACY
Admin Postal Code: REDACTED FOR PRIVACY
Admin Country: REDACTED FOR PRIVACY
Admin Phone: REDACTED FOR PRIVACY
Admin Phone Ext: REDACTED FOR PRIVACY
Admin Fax: REDACTED FOR PRIVACY
Admin Fax Ext: REDACTED FOR PRIVACY
Admin Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Tech ID: REDACTED FOR PRIVACY
Tech Name: REDACTED FOR PRIVACY
Tech Organization: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech City: REDACTED FOR PRIVACY
Tech State/Province: REDACTED FOR PRIVACY
Tech Postal Code: REDACTED FOR PRIVACY
Tech Country: REDACTED FOR PRIVACY
Tech Phone: REDACTED FOR PRIVACY
Tech Phone Ext: REDACTED FOR PRIVACY
Tech Fax: REDACTED FOR PRIVACY
Tech Fax Ext: REDACTED FOR PRIVACY
Tech Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Name Server: ns21.domaincontrol.com
Name Server: ns22.domaincontrol.com
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2021-02-03T16:22:44Z

Websites with Similar Names

Says-it.com
Loading...
Says.academy
Levels Auto Sales - Private Party Pricing at a Retail Car Lot #LevelUP 1500 N Oracle RD Tucson AZ 85705
Says.agency
Levels Auto Sales - Private Party Pricing at a Retail Car Lot #LevelUP 1500 N Oracle RD Tucson AZ 85705
Says.builders
Levels Auto Sales - Private Party Pricing at a Retail Car Lot #LevelUP 1500 N Oracle RD Tucson AZ 85705
Says.careers
Levels Auto Sales - Private Party Pricing at a Retail Car Lot #LevelUP 1500 N Oracle RD Tucson AZ 85705
Says.clothing
Levels Auto Sales - Private Party Pricing at a Retail Car Lot #LevelUP 1500 N Oracle RD Tucson AZ 85705

Recently Updated Websites

Videoanswers.media (11 seconds ago.)Koeppelonline.com (11 seconds ago.)Madrodeart.com (12 seconds ago.)Kozmazoltan.com (13 seconds ago.)Combativecardiokickboxing.com (14 seconds ago.)Akwugu.com (21 seconds ago.)Livewelltests.com (23 seconds ago.)Pitag.com (25 seconds ago.)Tdnzp.com (26 seconds ago.)Doomsdaygames.co.uk (27 seconds ago.)Preorder-manager.com (30 seconds ago.)Myofficelifi.com (33 seconds ago.)Night-hawk.com (37 seconds ago.)Sabuesosoftware.com (39 seconds ago.)Jusbeau.com (41 seconds ago.)Socialequitycompany.com (41 seconds ago.)Healthyeatinghappyliving.org (45 seconds ago.)Lisakusel.com (47 seconds ago.)Desbloqueodered.com (47 seconds ago.)Lovelivewilm.com (50 seconds ago.)Studentflyingclub.com (54 seconds ago.)Minyak-zamzam.com (56 seconds ago.)Vivasorrisos.com (58 seconds ago.)Getcourse.club (1 minute ago.)Badassmillionaires.com (1 minute ago.)Mansyurjerseystore.com (1 minute 4 seconds ago.)Thedabbygoat.com (1 minute 7 seconds ago.)Boldbowties.com (1 minute 8 seconds ago.)Sariwartiagung.com (1 minute 8 seconds ago.)Vintage-variations.com (1 minute 8 seconds ago.)

Recently Searched Keywords

tax management login (1 second ago.)levitra professional (1 second ago.)coolcuts (1 second ago.)big easy (1 second ago.)паспорт міста▿ (1 second ago.)style-k6gqqm9hnavcontainerarrow (1 second ago.)per le donne (1 second ago.)homes doubles (1 second ago.)who plays eve online (1 second ago.)sedona hotels (2 seconds ago.)nuuk (2 seconds ago.)propecia generico (2 seconds ago.)nieruchomosci glogow dolnoslaskie (2 seconds ago.)silk and satin brand (3 seconds ago.)pastiglie per dimagrire (3 seconds ago.)microsoft study (3 seconds ago.)apartmani rogoznica (4 seconds ago.)alıcıdan onay beklediklerim  (4 seconds ago.)most iconic movies (4 seconds ago.)calvizie (4 seconds ago.)september 9 2020 in roman numerals (5 seconds ago.)likewap.in tik tok (5 seconds ago.)xenical generico (5 seconds ago.)почему стройматериалы подорожали так сильно (6 seconds ago.)注意事項 (6 seconds ago.)игра активити купить украина (6 seconds ago.)juliette has a gun (6 seconds ago.)11月 (6 seconds ago.)lida daidaihua (6 seconds ago.)name from domainmarketcom (7 seconds ago.)