Individual Clients - SberBank

Safety: High trust score
Year Founded: 2008
Global Traffic Rank: 772
Estimated Worth: $23,586,120
Category: Finance > Banking



Domain summary

Last updated
2020-11-05
Domain label
sberbank
Domain extension
ru
Domain registered:
2008-07-24
Domain updated:
2020-11-05
Domain expires:
2021-07-24
Global Traffic Rank
772
Statvoo Rating
A
Trust Score
High trust score
Estimated worth
$23,586,120
Estimated daily income
$21,839
Estimated monthly income
$664,270

Rank summary

How is sberbank.ru ranked relative to other sites:

Percentage of visits to sberbank.ru from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Sberbank.ru registered?
A: Sberbank.ru was registered 12 years, 8 months, 2 weeks, 4 days, 20 minutes, 39 seconds ago on Thursday, July 24, 2008.
Q: When was the WHOIS for Sberbank.ru last updated?
A: The WHOIS entry was last updated 5 months, 6 days, 20 minutes, 39 seconds ago on Thursday, November 5, 2020.
Q: What are Sberbank.ru's nameservers?
A: DNS for Sberbank.ru is provided by the following nameservers:
  • ns2.gldn.net
  • ns3.gldn.net
Q: Who is the registrar for the Sberbank.ru domain?
A: The domain has been registered at RU-CENTER-REG-RIPN.
Q: What is the traffic rank for Sberbank.ru?
A: Sberbank.ru ranks 772 globally on Alexa. Sberbank.ru has a High trust score, and a Statvoo Rank of A.
Q: How many people visit Sberbank.ru each day?
A: Sberbank.ru receives approximately 2,729,927 visitors and 21,839,416 page impressions per day.
Q: What IP address does Sberbank.ru resolve to?
A: Sberbank.ru resolves to the IPv4 address 194.54.14.168.
Q: In what country are Sberbank.ru servers located in?
A: Sberbank.ru has servers located in the Russia.
Q: What webserver software does Sberbank.ru use?
A: Sberbank.ru is powered by webserver.
Q: Who hosts Sberbank.ru?
A: Sberbank.ru is hosted by OJSC Sberbank of Russia in Russia.
Q: How much is Sberbank.ru worth?
A: Sberbank.ru has an estimated worth of $23,586,120. An average daily income of approximately $21,839, which is roughly $664,270 per month.

Sberbank.ru Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Sberbank.ru Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Sberbank.ru

H1 Headings

0 :

H2 Headings

12 :
  1. Debit cards
  2. Cross-border transfers
  3. Send money at the bank office
  4. Transfers within Russia
  5. Sberbank Online app makes banking easier than ever
  6. We're always on call
  7. Comprehensive banking to help your business grow
  8. About Sberbank
  9. Contacts
  10. Quick links
  11. Social links
  12. Mobile applications

H3 Headings

5 :
  1. SberCard
  2. Large Bonuses Card
  3. Visa Digital
  4. Deposits
  5. Loans & mortgages

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

2 :

Total Images

46 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

31:

Links - Internal (nofollow)

0:

Links - Outbound

30:

Links - Outbound (nofollow)

0:

Keyword Cloud for Sberbank.ru

00contextitemname retailnamesendextendeditemname imagetextcontainerimagetextcontainertag containercookiesrussia1 orderimage uuidtransfer feedisplay10contextitemnameextendeditemname columnscontainer uuid00contextitemname retailcontextitemnamecolumnscontainer uuidsend moneystoreappsicontransfers0 order 00contextitemnamebankbankingimageorder 10contextitemname retailcontextitemnametemplateurlcontextrootstaticwidgetsbbhostrichtexttemplatehtmlarea 1 orderorder 00contextitemnameextendeditemname imagefunctioncolumnscontainerindividualtemplateurlcontextrootstaticwidgetsbbhostrichtexttemplatehtmlarea 0 ordernumbertag widget0 ordermoneycstartretailsw1 order 00contextitemnameyoutemplateurlcontextrootstaticwidgetsbbhostrichtexttemplatehtmlarea 0windowsbtextendeditemnamecurrencyorder 00contextitemname retailcontextitemname00contextitemnameextendeditemname columnscontainercontainer preferences backgroundcolorcsrfalseviewnamespacetemplatesimagetexttemplateshadowfalsepreset11titleretailcontextitemname retailnameclientsmaindepositssberbank10contextitemname retailcontextitemnameuuidifisansweredwidget preferencesbackgroundcolorcsrfalseviewnamespacetemplatesimagetexttemplateshadowfalsepreset11titletag container preferencescan1 order 10contextitemnamesberbank onlinereturnyourextendeditemname richtext10contextitemname retailcontextitemname retailnamenameclientsmain individual0order 10contextitemnametemplateurlcontextrootstaticwidgetsbbhostrichtexttemplatehtmlarea 1dataretailname00contextitemname retailcontextitemname retailnamethancontainerrichtext uuidorderrichtextpreferences backgroundcolorcsrfalseviewnamespacetemplatesimagetexttemplateshadowfalsepreset11titleextendeditemname imagetextcontainer uuidcontainer preferencesorder 00contextitemname retailnameimagetextcontainer uuidatmmoreretailcontextitemnamecardonlineratesvarextendeditemname richtext uuidwidgettemplateurlcontextrootstaticwidgetsbbhostrichtexttemplatehtmlarea1tag widget preferencespreferencescenterextendeditemname image uuidtransferpreventexchangetagfeebonuses

Longtail Keyword Density for Sberbank.ru

KeywordsOccurences
tag widget preferences26
extendeditemname richtext uuid13
tag container preferences10
order 00contextitemname retailname9
0 order 00contextitemname9
templateurlcontextrootstaticwidgetsbbhostrichtexttemplatehtmlarea 0 order7
extendeditemname imagetextcontainer uuid6
extendeditemname image uuid6
order 10contextitemname retailcontextitemname5
10contextitemname retailcontextitemname retailname5
templateurlcontextrootstaticwidgetsbbhostrichtexttemplatehtmlarea 1 order5
1 order 00contextitemname4
order 00contextitemname retailcontextitemname4
1 order 10contextitemname4
00contextitemname retailcontextitemname retailname4
container preferences backgroundcolorcsrfalseviewnamespacetemplatesimagetexttemplateshadowfalsepreset11title3
extendeditemname columnscontainer uuid3
0 order27
tag widget26
widget preferences26
richtext uuid13
order 00contextitemname13
extendeditemname richtext13
tag container10
container preferences10
retailcontextitemname retailname10
00contextitemname retailname9
1 order8
order 10contextitemname7
templateurlcontextrootstaticwidgetsbbhostrichtexttemplatehtmlarea 07
extendeditemname imagetextcontainer6
imagetextcontainer uuid6
extendeditemname image6
image uuid6
templateurlcontextrootstaticwidgetsbbhostrichtexttemplatehtmlarea 15
10contextitemname retailcontextitemname5
00contextitemname retailcontextitemname4
sberbank online4
transfer fee3
clientsmain individual3
extendeditemname columnscontainer3
columnscontainer uuid3
preferences backgroundcolorcsrfalseviewnamespacetemplatesimagetexttemplateshadowfalsepreset11title3
send money3
uuid37
tag36
extendeditemname36
preferences36
order36
028
widget26
retailname25
00contextitemname13
richtext13
your13
templateurlcontextrootstaticwidgetsbbhostrichtexttemplatehtmlarea13
name12
sberbank11
retailcontextitemname10
container10
19
function8
var7
10contextitemname7
bank7
online7
card7
image6
imagetextcontainer6
if6
data6
you6
money6
more6
rates5
individual5
currency5
exchange5
than4
transfers4
storeapps-icon4
c3
clientsmain3
columnscontainer3
backgroundcolorcsrfalseviewnamespacetemplatesimagetexttemplateshadowfalsepreset11title3
windowsbt3
number3
prevent3
cookies3
isanswered3
return3
russia3
deposits3
center3
display3
banking3
fee3
transfer3
send3
can3
bonuses3
atm3
startretailsw3

Who hosts Sberbank.ru?

Sberbank.ru Hosting Provider Information

Hosted IP Address:194.54.14.168
Hosted Hostname:194.54.14.168
Service Provider:OJSC Sberbank of Russia
Hosted Country:RussiaRU
Location Latitude:55.7386
Location Longitude:37.6068
Webserver Software:Not Applicable

Is "OJSC Sberbank of Russia" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
OJSC Sberbank of Russia
0.0000%

HTTP Header Analysis for Sberbank.ru

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 05 Nov 2020 14:12:22 GMT
Content-Type: text/html;charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
Expires: 0
Cache-Control: no-cache, no-store, max-age=0, must-revalidate
X-XSS-Protection: 1; mode=block
Pragma: no-cache
X-Frame-Options: SAMEORIGIN
X-Content-Type-Options: nosniff
Content-Language: en-US
Allow: GET, HEAD, OPTIONS
X-Forwarded-Site: new
Content-Encoding: gzip

Sberbank.ru Domain Nameserver Information

HostIP AddressCountry
ns2.gldn.net 194.67.2.109
ns3.gldn.net 194.67.7.1


Need to find out who hosts Sberbank.ru?


Domain Registration (WhoIs) information for Sberbank.ru

 % By submitting a query to RIPN's Whois Service
% you agree to abide by the following terms of use:
% http://www.ripn.net/about/servpol.html#3.2 (in Russian)
% http://www.ripn.net/about/en/servpol.html#3.2 (in English).

domain: SBERBANK.RU
nserver: ns1.sberbank.ru. 194.54.14.186
nserver: ns2.gldn.net.
nserver: ns2.sberbank.ru. 194.54.14.187
nserver: ns3.gldn.net.
state: REGISTERED, DELEGATED, VERIFIED
org: "Sberbank of Russia" PJSC
registrar: RU-CENTER-RU
admin-contact: https://www.nic.ru/whois
created: 2008-07-24T20:00:00Z
paid-till: 2021-07-24T21:00:00Z
free-date: 2021-08-25
source: TCI

Last updated on 2020-08-13T05:01:34Z

Websites with Similar Names

Sberb-china.com
sberb-china.com -&nbspsberb china Resources and Information.
Sberb.info
Домен не прилинкован ни к одной из директорий на сервере!
Sberbahk.com
sberbahk.com
Sberbanck.ru
sberbanck.ru
Sberbank-500.ru
Главная / Sber500
Sberbank-900.ru
Сбербанк Онлайн - вход в личный кабинет, вход в систему, войти в интернет банкинг, обзор | Сбербанк России инструкция
Sberbank-am.ru
УК Сбер Управление Активами. Инвестиции: ПИФы, ИИС, доверительное управление.

Recently Updated Websites

Farmacotherapy.com (2 seconds ago.)Alvarolopescardoso.com (2 seconds ago.)Prontaentrega.online (3 seconds ago.)Trucinnect.com (3 seconds ago.)Beefyqueen.com (4 seconds ago.)Kajunsensationcatering.com (4 seconds ago.)Librokamasutra.com.ar (4 seconds ago.)Recruitics.com (4 seconds ago.)Storefrontzone.com (5 seconds ago.)Weddingphotoibiza.com (5 seconds ago.)Ev-duisburg.de (6 seconds ago.)Jeldwenworkplace.com (6 seconds ago.)Mauropedretti.net (6 seconds ago.)Binjai.online (7 seconds ago.)Snapchatlogin.us (8 seconds ago.)Elnasrcar.com (9 seconds ago.)Expediteimpex.com (9 seconds ago.)Flowbird.group (9 seconds ago.)Auditonline.gov.in (10 seconds ago.)Vintagepreserve.com (11 seconds ago.)Speedfirenetwork.net (11 seconds ago.)Intercomex-global.online (12 seconds ago.)Ballerinafit.com (12 seconds ago.)Electronicpromo.ru (12 seconds ago.)Principlemediagroup.com (13 seconds ago.)Futurenepal.org (13 seconds ago.)Fabrika-slov.com (14 seconds ago.)Tradingfashionstore.info (14 seconds ago.)Hydrotint.com (14 seconds ago.)Actsofthemessiah.com (15 seconds ago.)

Recently Searched Keywords

fairview recreation (11 seconds ago.)info-element-description--itemdescriptionfontcolorslideshow 2f2e2e--itemdescriptionfontslideshow normal (14 seconds ago.)holdmycourt sun city grand (19 seconds ago.)blind (21 seconds ago.)bitcoin explorer app (22 seconds ago.)pinky (24 seconds ago.)proactively scan your site (25 seconds ago.)chế độ ăn uống như thế nào là hợp lý với các bệnh nhân bị trào ngược dạ dày (27 seconds ago.)haftpflichtversicherung auto vergleich schweiz (31 seconds ago.)69slam switzerland (32 seconds ago.)data url (33 seconds ago.)route des vins (34 seconds ago.)voće (35 seconds ago.)share status video whatsapp (36 seconds ago.)поступление чучел mojo (37 seconds ago.)ltr (37 seconds ago.)podcast episode (39 seconds ago.)scanners (0) (40 seconds ago.)professional login (42 seconds ago.)podovi za teretane (44 seconds ago.)there should (48 seconds ago.)кроватки с маятниковым механизмом (49 seconds ago.)dmjy.com (49 seconds ago.)desk fan (51 seconds ago.)ffb-divider-2 width100px (51 seconds ago.)video communication (53 seconds ago.)les (56 seconds ago.)plastics chemicals (1 minute 7 seconds ago.)ack25er (1 minute 9 seconds ago.)ye girii (1 minute 13 seconds ago.)