Sbpdcl.in Website Information

Sbpdcl.in has a Low Trust Score, a Statvoo Rank of H, an Alexa Rank of 96,179, a Majestic Rank of 998,902, a Domain Authority of 19% and is not listed in DMOZ.

Sbpdcl.in is hosted by Software Technology Parks of India - Bangalore in India.
Sbpdcl.in has an IP Address of 203.129.205.88 and a hostname of 203.129.205.88.

The domain sbpdcl.in was registered 6 years 4 months 1 week ago by , it was last modified 4 years 4 months 3 weeks ago and currently is set to expire 3 years 4 months 1 week ago.


Whois information for sbpdcl.in

Full Whois Lookup for Sbpdcl.in Whois Lookup

Access to .IN WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the .IN registry database. The data in this record is provided by .IN Registry for informational purposes only, and .IN does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. .IN reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.

Domain ID:D7143993-AFIN
Domain Name:SBPDCL.IN
Created On:13-Mar-2013 16:56:20 UTC
Last Updated On:14-Mar-2017 03:55:15 UTC
Expiration Date:13-Mar-2018 16:56:20 UTC
Sponsoring Registrar:Suryanandan.net (R152-AFIN)
Status:CLIENT TRANSFER PROHIBITED
Reason:
Registrant ID:PD_26930436
Registrant Name:Managing Director
Registrant Organization:South Bihar Power Distribution Company Limited
Registrant Street1:South Bihar Power Distribution Company Limited (Sbpdcl.in)
Registrant Street2:
Registrant Street3:
Registrant City:PATNA
Registrant State/Province:Bihar
Registrant Postal Code:800001
Registrant Country:IN
Registrant Phone:+91.2560005
Registrant Phone Ext.:
Registrant FAX:
Registrant FAX Ext.:
Registrant Login to show email
ID:PD_26930436
Admin Name:Managing Director
Admin Organization:South Bihar Power Distribution Company Limited
Admin Street1:South Bihar Power Distribution Company Limited (Sbpdcl.in)
Admin Street2:
Admin Street3:
Admin City:PATNA
Admin State/Province:Bihar
Admin Postal Code:800001
Admin Country:IN
Admin Phone:+91.2560005
Admin Phone Ext.:
Admin FAX:
Admin FAX Ext.:
Admin Login to show email
ID:PD_26930436
Tech Name:Managing Director
Tech Organization:South Bihar Power Distribution Company Limited
Tech Street1:South Bihar Power Distribution Company Limited (Sbpdcl.in)
Tech Street2:
Tech Street3:
Tech City:PATNA
Tech State/Province:Bihar
Tech Postal Code:800001
Tech Country:IN
Tech Phone:+91.2560005
Tech Phone Ext.:
Tech FAX:
Tech FAX Ext.:
Tech Login to show email
Server:CSM2.CSMPL.COM
Name Server:CSM1.CSMPL.COM
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
DNSSEC:Unsigned

Who hosts Sbpdcl.in?

Sbpdcl.in Web Server Information

Hosted IP Address:203.129.205.88
Hosted Hostname:203.129.205.88
Service Provider:Software Technology Parks of India - Bangalore
Hosted Country:IndiaIN
Location Latitude:20
Location Longitude:77
Webserver Software:Not Applicable

HTTP Header Analysis for Sbpdcl.in

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
ETag:
Vary: Accept-Encoding
Server: Microsoft-IIS/7.5
X-AspNet-Version: 2.0.50727
Date: Sun, 16 Aug 2015 13:39:42 GMT
Content-Length: 14927


Need to find out who hosts Sbpdcl.in?

Sbpdcl.in Free SEO Report

Website Inpage Analysis for Sbpdcl.in

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Sbpdcl.in

nbsp transferfalse ifsiteconsumer2017 transfernopasswordnotificationreturndatefunctionjulpostingfalsetruetokendocumentreadyfunctionreturn false if0nbspvide notificationsbpdclreturn falsetoken nojul 2017nbsp nbspnamevideelsetransfervartickerifprojectstransfer and posting

Longtail Keyword Density for Sbpdcl.in

KeywordsOccurences
transfer and posting5
return false if4
return false9
token no4
nbsp nbsp4
false if4
2017 transfer3
vide notification3
nbsp transfer3
jul 20173
var14
return12
no10
nbsp9
function9
false9
if8
posting8
transfer7
vide6
true5
ticker4
else4
notification4
sbpdcl4
token4
date4
04
documentreadyfunction3
jul3
projects3
consumer3
site3
name3
password3

What are the nameservers for sbpdcl.in?

Sbpdcl.in Domain Nameserver Information

HostIP AddressCountry
csm2.csmpl.com 203.129.205.10India India
csm1.csmpl.com 203.129.205.9India India

Sbpdcl.in Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Sbpdcl.in is a scam?