Частным клиентам — СберБанк

Safety: High trust score
Year Founded: 1998
Global Traffic Rank: 2,832
Estimated Worth: $5,652,720
Category: Finance > Banking

Банковские услуги частным клиентам. Кредиты и вклады, ипотека, дебетовые и кредитные карты и другие банковские услуги для физических лиц.



Domain summary

Last updated
2021-04-05
Domain label
sbrf
Domain extension
ru
Domain registered:
1998-07-13
Domain updated:
2021-04-05
Domain expires:
2021-07-31
Global Traffic Rank
2,832
Statvoo Rating
B
Trust Score
High trust score
Estimated worth
$5,652,720
Estimated daily income
$5,234
Estimated monthly income
$159,201

Frequently Asked Questions (FAQ)

Q: When was Sbrf.ru registered?
A: Sbrf.ru was registered 22 years, 11 months, 1 week, 4 days, 9 hours, 48 minutes, 31 seconds ago on Monday, July 13, 1998.
Q: When was the WHOIS for Sbrf.ru last updated?
A: The WHOIS entry was last updated 2 months, 2 weeks, 5 days, 9 hours, 48 minutes, 31 seconds ago on Monday, April 5, 2021.
Q: What are Sbrf.ru's nameservers?
A: DNS for Sbrf.ru is provided by the following nameservers:
  • ns2.gldn.net
  • ns3.gldn.net
Q: Who is the registrar for the Sbrf.ru domain?
A: The domain has been registered at RU-CENTER-REG-RIPN.
Q: What is the traffic rank for Sbrf.ru?
A: Sbrf.ru ranks 2,832 globally on Alexa. Sbrf.ru has a High trust score, and a Statvoo Rank of B.
Q: How many people visit Sbrf.ru each day?
A: Sbrf.ru receives approximately 654,304 visitors and 5,234,432 page impressions per day.
Q: What IP address does Sbrf.ru resolve to?
A: Sbrf.ru resolves to the IPv4 address 194.54.14.129.
Q: In what country are Sbrf.ru servers located in?
A: Sbrf.ru has servers located in the Russia.
Q: What webserver software does Sbrf.ru use?
A: Sbrf.ru is powered by webserver.
Q: Who hosts Sbrf.ru?
A: Sbrf.ru is hosted by OJSC Sberbank of Russia in Russia.
Q: How much is Sbrf.ru worth?
A: Sbrf.ru has an estimated worth of $5,652,720. An average daily income of approximately $5,234, which is roughly $159,201 per month.

Sbrf.ru Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Sbrf.ru Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Sbrf.ru

H1 Headings

1 :
  1. Полезные статьи

H2 Headings

8 :
  1. СберКарта Mastercard
  2. Молодежная дебетовая карта
  3. Пенсионная карта
  4. Все продукты и услуги
  5. Контактная информация
  6. Коммуникации с клиентами
  7. Сбербанк в социальных сетях
  8. Приложения

H3 Headings

21 :
  1. Начните год с инвестиций
  2. Вклад «Дополнительный процент»
  3. Нужны деньги?
  4. Смотрите что хотите со SberBox
  5. Экономьте на связи со СберМобайл
  6. СберЗдоровье делает заботу о себе проще
  7. Бесплатная карта для детей
  8. Получите хорошее образование
  9. Ипотека для семей с детьми
  10. Квартиры в новостройках
  11. Ипотека, выгодная вам
  12. Анализ цены
  13. Станьте самозанятым со СберБанком
  14. Все о налоговом режиме для самозанятых
  15. Бесплатный пакет услуг Своё дело
  16. Откройте бизнес по франшизе
  17. Откройте бизнес от 0 ₽
  18. Пакеты услуг и опции для ведения бизнеса
  19. Специальные условия для пенсионеров
  20. Как подготовиться к выходу на пенсию?
  21. Журнал «Активный возраст»

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

2 :

Total Images

144 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

233:

Links - Internal (nofollow)

0:

Links - Outbound

80:

Links - Outbound (nofollow)

0:

Keyword Cloud for Sbrf.ru

templateurlcontextrootstaticwidgetsbbhostrichtexttemplatehtmlareacontacttypecontactpoint telephonehttpschemaorg1 order 00contextitemnameurlpreferences backgroundcolorcsrfalseviewnamespacetemplatesimagetexttemplateshadowfalsepreset11promotitleextendeditemname columnscontainer uuidcontext httpschemaorg namec paddingbottomnonewithpaddingfalsetemplatenamecolumnscontainertemplatepaddingtopnonecols121241212412124area10contextitemname retailcontextitemname00childrenwindowsbtretailcontextitemnamefunction vartag widgettag containerorderextendeditemname image uuidimagetextcontainer2 order 10contextitemnameextendeditemname richtext uuidextendeditemname imagetextcontainer uuidtelephonebackgroundcolorcsrfalseviewnamespacesbbundlepresetcustomtitle c paddingbottomnonewithpaddingfalsetemplatenamecolumnscontainertemplatepaddingtopnonecols121241212412124area495 5005550templateurlcontextrootstaticwidgetsbbhostrichtexttemplatehtmlarea 1order 20children nametype1richtext uuidcontextretailnametrue0 orderretailcontextitemname retailnamehttpswwwsberbankruportalserverstatictemplates5bbbhost5drumasterpagetemplatestaticandroidchrome192x192png2 order 00contextitemnamefunction20 order 10contextitemnamehttpschemaorg namepreferences backgroundcolorcsrfalseviewnamespacesbbundlepresetcustomtitleurl httpswwwsberbankrurupersonorder 00childrencontext httpschemaorgtag widget preferenceswidget preferencestemplateurlcontextrootstaticwidgetsbbhostrichtexttemplatehtmlarea 0order 20contextitemname retailcontextitemname4ifbackgroundcolorcsrfalseviewnamespacesbbundlepresetcustomtitlecolumnscontainer uuidorder 10contextitemnameorder 10contextitemname retailcontextitemnamepreferences backgroundcolorcsrfalseviewnamespacesbbundlepresetcustomtitle ccontainer20contextitemname retailcontextitemname retailnamereturnimagetextcontainer uuidtype contactpoint telephone00contextitemname10contextitemnamecontacttype type contactpoint37 495 500555000children namecontactpointvar500contextitemname retailnametemplateurlcontextrootstaticwidgetsbbhostrichtexttemplatehtmlarea 0 ordertag container preferencestemplateurlcontextrootstaticwidgetsbbhostrichtexttemplatehtmlarea 1 orderextendeditemname columnscontainerareaorder 00contextitemname retailnamewidget2 orderimagearea 0 orderorder 00children nametemplateurlcontextrootstaticwidgetsbbhostrichtexttemplatehtmlarea 2startretailswextendeditemname imagerichtext3 order0extendeditemname imagetextcontainer00contextitemname retailcontextitemnameorder 00contextitemname retailcontextitemnamecontainer preferences backgroundcolorcsrfalseviewnamespacesbbundlepresetcustomtitlecorder 00contextitemname1 order 10contextitemnamenamearea 0backgroundcolorcsrfalseviewnamespacetemplatesimagetexttemplateshadowfalsepreset11promotitleextendeditemname richtextbackgroundcolorcsrfalseviewnamespacesbbundlepresetcustomtitle cisanswered1 order10contextitemname retailcontextitemname retailnameimage uuidcontainer preferences backgroundcolorcsrfalseviewnamespacetemplatesimagetexttemplateshadowfalsepreset11promotitletemplateurlcontextrootstaticwidgetsbbhostrichtexttemplatehtmlarea 2 orderpreferencesextendeditemname20contextitemname0 order 00contextitemname10contextitemname retailname6uuidcontacttype typepaddingbottomnonewithpaddingfalsetemplatenamecolumnscontainertemplatepaddingtopnonecols121241212412124areahttpswwwsberbankrurupersontag500555020children nameqrcontainer preferences7 49500contextitemname retailcontextitemname retailnameareaserved contacttypecolumnscontainercookies20childrenorder 10contextitemname retailname20contextitemname retailcontextitemnametype contactpointorder 20contextitemnameareaservedorder 20children

Longtail Keyword Density for Sbrf.ru

KeywordsOccurences
tag widget preferences67
extendeditemname richtext uuid29
extendeditemname image uuid28
order 00contextitemname retailname26
order 10contextitemname retailname21
tag container preferences16
0 order 00contextitemname13
templateurlcontextrootstaticwidgetsbbhostrichtexttemplatehtmlarea 1 order11
0 order 10contextitemname10
templateurlcontextrootstaticwidgetsbbhostrichtexttemplatehtmlarea 0 order9
1 order 00contextitemname9
preferences backgroundcolorcsrfalseviewnamespacesbbundlepresetcustomtitle c9
extendeditemname columnscontainer uuid9
container preferences backgroundcolorcsrfalseviewnamespacesbbundlepresetcustomtitle9
1 order 10contextitemname8
templateurlcontextrootstaticwidgetsbbhostrichtexttemplatehtmlarea 2 order8
2 order 10contextitemname8
backgroundcolorcsrfalseviewnamespacesbbundlepresetcustomtitle c paddingbottomnonewithpaddingfalsetemplatenamecolumnscontainertemplatepaddingtopnonecols12-12-412-12-412-12-4area7
order 00children name7
2 order 00contextitemname7
order 10contextitemname retailcontextitemname6
type contactpoint telephone6
10contextitemname retailcontextitemname retailname5
order 00contextitemname retailcontextitemname4
00contextitemname retailcontextitemname retailname4
contacttype type contactpoint4
order 20contextitemname retailcontextitemname3
20contextitemname retailcontextitemname retailname3
context httpschemaorg name3
area 0 order3
order 20children name3
extendeditemname imagetextcontainer uuid3
container preferences backgroundcolorcsrfalseviewnamespacetemplatesimagetexttemplateshadowfalsepreset11promotitle3
7 495 500-55-503
tag widget67
widget preferences67
0 order38
order 00contextitemname30
extendeditemname richtext29
richtext uuid29
image uuid28
extendeditemname image28
order 10contextitemname27
00contextitemname retailname26
10contextitemname retailname21
1 order19
2 order17
container preferences16
tag container16
retailcontextitemname retailname14
templateurlcontextrootstaticwidgetsbbhostrichtexttemplatehtmlarea 111
backgroundcolorcsrfalseviewnamespacesbbundlepresetcustomtitle c9
preferences backgroundcolorcsrfalseviewnamespacesbbundlepresetcustomtitle9
extendeditemname columnscontainer9
columnscontainer uuid9
templateurlcontextrootstaticwidgetsbbhostrichtexttemplatehtmlarea 09
templateurlcontextrootstaticwidgetsbbhostrichtexttemplatehtmlarea 28
c paddingbottomnonewithpaddingfalsetemplatenamecolumnscontainertemplatepaddingtopnonecols12-12-412-12-412-12-4area7
order 00children7
00children name7
contactpoint telephone6
type contactpoint6
10contextitemname retailcontextitemname6
order 20contextitemname4
00contextitemname retailcontextitemname4
3 order4
areaserved contacttype4
contacttype type4
context httpschemaorg4
7 4953
area 03
20children name3
order 20children3
url httpswwwsberbankruruperson3
httpschemaorg name3
20contextitemname retailcontextitemname3
495 500-55-503
extendeditemname imagetextcontainer3
imagetextcontainer uuid3
preferences backgroundcolorcsrfalseviewnamespacetemplatesimagetexttemplateshadowfalsepreset11promotitle3
function var3
uuid84
tag83
preferences83
extendeditemname83
order83
widget67
retailname66
040
00contextitemname30
image30
templateurlcontextrootstaticwidgetsbbhostrichtexttemplatehtmlarea29
richtext29
10contextitemname27
name21
120
219
retailcontextitemname16
container16
type12
c10
columnscontainer9
var9
backgroundcolorcsrfalseviewnamespacesbbundlepresetcustomtitle9
function9
paddingbottomnonewithpaddingfalsetemplatenamecolumnscontainertemplatepaddingtopnonecols12-12-412-12-412-12-4area7
00children7
contactpoint6
telephone6
areaserved6
contacttype6
windowsbt5
if5
35
44
httpschemaorg4
context4
qr-4
area4
20contextitemname4
true4
httpswwwsberbankruportalserverstatictemplates5bbbhost5drumasterpagetemplatestaticandroid-chrome-192x192png4
backgroundcolorcsrfalseviewnamespacetemplatesimagetexttemplateshadowfalsepreset11promotitle3
imagetextcontainer3
return3
cookies3
isanswered3
53
500-55-503
20children3
63
url3
httpswwwsberbankruruperson3
startretailsw3

Who hosts Sbrf.ru?

Sbrf.ru Hosting Provider Information

Hosted IP Address:194.54.14.129
Hosted Hostname:194.54.14.129
Service Provider:OJSC Sberbank of Russia
Hosted Country:RussiaRU
Location Latitude:55.7386
Location Longitude:37.6068
Webserver Software:Not Applicable

Is "OJSC Sberbank of Russia" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.1842%
AS-26496-GO-DADDY-COM-LLC
4.0884%
NAMECHEAP-NET
3.5315%
GoDaddy.com, LLC
2.6631%
AMAZON-AES
2.5761%
UNIFIEDLAYER-AS-1
2.1530%
Fara Negar Pardaz Khuzestan
1.9418%
Unknown
1.8112%
1&1 Internet AG
1.6678%
CONFLUENCE-NETWORK-INC
1.6554%
OJSC Sberbank of Russia
0.0000%

HTTP Header Analysis for Sbrf.ru

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
date: Mon, 05 Apr 2021 17:40:15 GMT
content-type: text/html;charset=UTF-8
vary: Accept-Encoding
expires: 0
cache-control: no-cache, no-store, max-age=0, must-revalidate
x-xss-protection: 1; mode=block
pragma: no-cache
x-frame-options: SAMEORIGIN
x-content-type-options: nosniff
content-language: en-US
allow: GET, HEAD, OPTIONS
x-forwarded-site: new
content-encoding: gzip
Transfer-Encoding: chunked

Sbrf.ru Domain Nameserver Information

HostIP AddressCountry
ns2.gldn.net 194.67.2.109
ns3.gldn.net 194.67.7.1


Need to find out who hosts Sbrf.ru?


Domain Registration (WhoIs) information for Sbrf.ru

 % By submitting a query to RIPN's Whois Service
% you agree to abide by the following terms of use:
% http://www.ripn.net/about/servpol.html#3.2 (in Russian)
% http://www.ripn.net/about/en/servpol.html#3.2 (in English).

domain: SBRF.RU
nserver: ns1.sberbank.ru.
nserver: ns2.gldn.net.
nserver: ns2.sberbank.ru.
nserver: ns3.gldn.net.
state: REGISTERED, DELEGATED, VERIFIED
org: Sberbank of Russia
registrar: BEELINE-RU
admin-contact: http://whois.beeline.ru
created: 1998-07-13T12:09:06Z
paid-till: 2021-07-31T21:00:00Z
free-date: 2021-09-01
source: TCI

Last updated on 2021-04-05T17:36:30Z

Websites with Similar Names

Sbrf-online.ru
SBRF-ONLINE.RU
Sbrf.com.ua
Главная Сбербанк в Украине
Sbrf.ru
Частным клиентам — СберБанк
Sbrf.today
sbrf.today - Registered at Namecheap.com

Recently Updated Websites

Mybroadcastingcorp.com (2 seconds ago.)Rockyrivernutrition.net (2 seconds ago.)Passiona.xyz (3 seconds ago.)Yayubet6850.com (3 seconds ago.)Lfjsq.cn (6 seconds ago.)Lowolfsounds.com (7 seconds ago.)Dreamparks.org (7 seconds ago.)Luzwellnessandyoga.com (8 seconds ago.)Crmoss.net (9 seconds ago.)Thefarmerschoicellc.com (10 seconds ago.)Nachitools.com (10 seconds ago.)Spakrsevasansthan.com (11 seconds ago.)Officialpawtracks.com (11 seconds ago.)Bitfabriek.com (12 seconds ago.)Zero-prooflife.info (12 seconds ago.)Adventureinpictures.com (13 seconds ago.)Viral.ws (14 seconds ago.)Gates.camp (14 seconds ago.)Danivasa.com (15 seconds ago.)Iwantwastelandbdsm.com (16 seconds ago.)B-cal.com (16 seconds ago.)Remedyhealthandwellness.com (16 seconds ago.)Theatticliverpool.com (16 seconds ago.)Newkeygayrimenkul.com (17 seconds ago.)Whatdoesamericamean.us (17 seconds ago.)Giovannaangulo.com (17 seconds ago.)Simple.ac (17 seconds ago.)Valleypropertiesaz.com (18 seconds ago.)Brentsdrivingschool.com (18 seconds ago.)Thewineroom.ca (18 seconds ago.)

Recently Searched Keywords

bobs mini storage (1 second ago.)text-shadow -3px 2px (1 second ago.)04so (1 second ago.)renda fixa fundos (3 seconds ago.)hotscheidules (4 seconds ago.)单位不给工伤认定书怎么办 (5 seconds ago.)вакуумные насосы value vri (5 seconds ago.)titlemalacca (7 seconds ago.)dirrtl 1dizr (7 seconds ago.)provisionales provisionales (7 seconds ago.)esclusivo ecco gli stipendi di tutti i giocatori di serie a (8 seconds ago.)wariverfronts (10 seconds ago.)8211 objects part (10 seconds ago.)1bordersolid rgba65 (11 seconds ago.)do 15000 (11 seconds ago.)me ds (16 seconds ago.)rugbytv europe (17 seconds ago.)은행동퀵 (18 seconds ago.)olma oumlzelliini (19 seconds ago.)pengeluaran sgp hari rabu (20 seconds ago.)ptscol-3 (22 seconds ago.)201000_ffe_nl_image.jpg (23 seconds ago.)12tree panama (23 seconds ago.)website planet (24 seconds ago.)venta (25 seconds ago.)weddingplanner (26 seconds ago.)vio (27 seconds ago.)gaglioppo (28 seconds ago.)diamond safety (29 seconds ago.)euescortgirls.com (30 seconds ago.)