scinexx | Wissensmagazin mit News aus Wissenschaft und Forschung

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: 55,631
Estimated Worth: $257,040
Last updated:2020-12-06
Category: Science

Die Welt der Wissenschaft und Forschung - aktuell, seriös und kostenlos berichten wir über spannende Forschungsergebnisse und Entdeckungen.


Domain summary

Domain label
scinexx
Domain extension
de
Global Traffic Rank
55,631
Statvoo Rating
D
Trust Score
Low Trust Score
Estimated worth
$257,040
Estimated daily income
$357
Estimated monthly income
$10,859

Rank summary

How is scinexx.de ranked relative to other sites:

Percentage of visits to scinexx.de from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Scinexx.de registered?
A: Scinexx.de was registered 3 months, 7 hours, 51 minutes, 32 seconds ago on Sunday, December 6, 2020.
Q: When was the WHOIS for Scinexx.de last updated?
A: The WHOIS entry was last updated 1 year, 6 months, 6 days, 7 hours, 51 minutes, 32 seconds ago on Saturday, August 31, 2019.
Q: What are Scinexx.de's nameservers?
A: DNS for Scinexx.de is provided by the following nameservers:
  • ns1077.ui-dns.biz
  • ns1077.ui-dns.com
  • ns1077.ui-dns.de
  • ns1077.ui-dns.org
Q: Who is the registrar for the Scinexx.de domain?
A: The domain has been registered at DENIC eG.
Q: What is the traffic rank for Scinexx.de?
A: Scinexx.de ranks 55,631 globally on Alexa. Scinexx.de has a Low Trust Score, and a Statvoo Rank of D.
Q: How many people visit Scinexx.de each day?
A: Scinexx.de receives approximately 29,724 visitors and 178,344 page impressions per day.
Q: What IP address does Scinexx.de resolve to?
A: Scinexx.de resolves to the IPv4 address 94.130.6.186.
Q: In what country are Scinexx.de servers located in?
A: Scinexx.de has servers located in the Germany.
Q: What webserver software does Scinexx.de use?
A: Scinexx.de is powered by Nginx webserver.
Q: Who hosts Scinexx.de?
A: Scinexx.de is hosted by D2 International Investment Ukraine LLC in Germany.
Q: How much is Scinexx.de worth?
A: Scinexx.de has an estimated worth of $257,040. An average daily income of approximately $357, which is roughly $10,859 per month.

Scinexx.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Scinexx.de Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Scinexx.de

H1 Headings

0 :

H2 Headings

30 :
  1. Wie sieht der nächste Superkontinent aus?
  2. Gaias schärfster Blick auf die Milchstraße
  3. Special: Coronavirus und Covid-19
  4. BusinessNews
  5. Krebserkrankungen über die Atemluft erkennen
  6. Anonym im Netz: VPN & andere Tools für mehr Sicherheit
  7. MRT-Aufnahmen: Effizienter, leiser und schneller
  8. Eisschilde an den Polen beeinflussen sich gegenseitig
  9. Xiaomi, Apple und Co. – Was die neuen Handys können und wie man mit Raten, Spartarifen und Co. günstig an die neuesten Modelle kommt
  10. Warum haben wir Fingerabdrücke?
  11. Finale der Probenmission Hayabusa 2
  12. Das Schwerpunktthema der Woche
  13. Jagd auf Hightech-Metalle
  14. Neuer Wert für die Feinstrukturkonstante
  15. Klima: Hat Asien einen Kipppunkt erreicht?
  16. Bild der Woche
  17. Eine Quantenrose im Graphen
  18. Corona: Was steckt hinter der unbemerkten Luftnot?
  19. Erdbeben in Köln – was wäre wenn?
  20. Wer nutzt das Dark Web und wofür?
  21. Arktis: Realität überholt Prognosen
  22. Indiz für neue Physik in der Hintergrundstrahlung?
  23. Wie SARS-CoV-2 ins Gehirn gelangt
  24. KI-System knackt Proteincode
  25. Mond: Droht Streit um die Ressourcen?
  26. Wie sieht der nächste Superkontinent aus?
  27. Gaias schärfster Blick auf die Milchstraße
  28. Neuer Wert für die Feinstrukturkonstante
  29. Arktis: Realität überholt Prognosen
  30. Indiz für neue Physik in der Hintergrundstrahlung?

H3 Headings

0 :

H4 Headings

15 :
  1. In den Schlagzeilen
  2. Top-Clicks der Woche
  3. Newsletter
  4. Earthview Aktuell
  5. Fast Forward Science 2020
  6. TV-Tipp
  7. Wissenswert
  8. Quiz
  9. Aktuelle Dossiers
  10. Im Web entdeckt
  11. Themen
  12. Rubriken
  13. Social Media
  14. Partner
  15. Service

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

44 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-3368393-1

Links - Internal

102:

Links - Internal (nofollow)

0:

Links - Outbound

24:

Links - Outbound (nofollow)

0:

Keyword Cloud for Scinexx.de

cover marginbottom 20unseresdiemarginbottomphysikimvarenergielernweltenscinexxumbusinessnewspearthview2 0 2width 100 heightkastenschwerpunktthemaeine2 0dezember 2020truefontweightdezemberpaddingfunctionum die100 height 120px4einiamcodesichauchnewsletterwieobjectfit cover marginbottom1aus0 2100 heightneuermitescheckfrimgoderheightsiehtblickwochedasauf120px objectfit coverheight 120pximg widthschlagzeilen2 marginbottom120px objectfitwie siehtcover1 dezember 2020objectfitimg width 1003120pxeinerdossierscoronavirusmarginbottom 2derfr dievonheight 120px objectfitder wochematerieobjectfit coverwidthsuperkontinentco2ssindwidth 100colormarginbottom 0backgroundcolor1 dezemberdensiecover marginbottom

Longtail Keyword Density for Scinexx.de

KeywordsOccurences
img width 1004
width 100 height4
height 120px object-fit4
120px object-fit cover4
object-fit cover margin-bottom4
cover margin-bottom 24
1 dezember 20203
2 0 23
100 height 120px3
margin-bottom 27
height 120px6
fr die6
object-fit cover6
img width5
120px object-fit4
100 height4
width 1004
dezember 20204
0 24
margin-bottom 04
cover margin-bottom4
wie sieht3
2 margin-bottom3
2 03
der woche3
1 dezember3
um die3
die25
der20
016
fr16
margin-bottom12
110
auf10
wie10
29
var9
height8
das7
mit7
img7
kasten-schwerpunktthema7
eine7
120px6
width6
cover6
den6
object-fit6
36
von5
es5
padding5
dezember4
schlagzeilen4
color4
ein4
scinexx4
oder4
materie4
im4
sie4
earthview4
um4
physik4
background-color4
44
energie4
co4
p4
font-weight3
sind3
function3
woche3
newsletter3
check3
s3
iamcode3
true3
lernwelten3
businessnews3
dossiers3
sieht3
unseres3
superkontinent3
aus3
blick3
sich3
einer3
neuer3
auch3
coronavirus3

Who hosts Scinexx.de?

Scinexx.de Hosting Provider Information

Hosted IP Address:94.130.6.186
Hosted Hostname:www.scinexx.de
Service Provider:D2 International Investment Ukraine LLC
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:nginx

Is "D2 International Investment Ukraine LLC" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
38.7768%
GoDaddy.com, LLC
20.0663%
Namecheap, Inc.
9.8730%
Confluence Networks Inc
6.3707%
Google Inc.
6.0392%
Merit Network Inc.
4.3939%
Amazon.com, Inc.
4.2919%
1&1 Internet AG
4.2685%
Fara Negar Pardaz Khuzestan
3.8053%
Cogent Communications
3.5576%
D2 International Investment Ukraine LLC
0.2280%

HTTP Header Analysis for Scinexx.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Sun, 06 Dec 2020 16:30:02 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
Link:; rel=shortlink
SNX-Cache: HIT
Content-Encoding: gzip

Scinexx.de Domain Nameserver Information

HostIP AddressCountry
ns1077.ui-dns.biz 217.160.81.77
ns1077.ui-dns.com 217.160.82.77
ns1077.ui-dns.de 217.160.80.77
ns1077.ui-dns.org 217.160.83.77


Need to find out who hosts Scinexx.de?


Domain Registration (WhoIs) information for Scinexx.de

 % Restricted rights.
%
% Terms and Conditions of Use
%
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
%
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
%

Domain: scinexx.de
Nserver: ns1077.ui-dns.biz
Nserver: ns1077.ui-dns.com
Nserver: ns1077.ui-dns.de
Nserver: ns1077.ui-dns.org
Status: connect
Changed: 2019-08-31T10:33:39+02:00

Websites with Similar Names

Recently Updated Websites

Styleandglamrunwayweek.com (1 second ago.)Auntymaza.com (1 second ago.)Scobelizer.com (1 second ago.)Turbpprepaidcard.com (2 seconds ago.)Saudeclassea.site (3 seconds ago.)Theforestwellness.com (4 seconds ago.)Ardutronics.com (4 seconds ago.)Fasbnet.com (4 seconds ago.)Crouchjoslyngood.com (5 seconds ago.)Zumbauernhof.ch (5 seconds ago.)Maariankorupaja.info (5 seconds ago.)Internshipsthailand.com (5 seconds ago.)Balvikasschool.com (5 seconds ago.)Twiningconsulting.com (6 seconds ago.)Risenchristacademy.com (6 seconds ago.)Vega-engineering.com (6 seconds ago.)Purepowerlifting.com (6 seconds ago.)Josephrunklecpa.com (7 seconds ago.)Joemoranphoto.com (7 seconds ago.)Fordpickup.club (7 seconds ago.)Sjoberglaw.com (7 seconds ago.)Frugallivingnorthwest.org (7 seconds ago.)Gnzbaptistchurch.net (8 seconds ago.)Camtouch.info (8 seconds ago.)Mlundylaw.com (8 seconds ago.)Drogueriacodifarm.com (9 seconds ago.)Mediaprotection.world (10 seconds ago.)Chaosfitapperalco.com (10 seconds ago.)Hairsalonlouisvilleky.com (10 seconds ago.)Librajewellerystudio.com (11 seconds ago.)

Recently Searched Keywords

è¨ççãàçï (1 second ago.)saddlery (2 seconds ago.)kaleva deco (2 seconds ago.)seregno (3 seconds ago.)prnewswire press release (4 seconds ago.)rosacea treatment (5 seconds ago.)start 1 grabcursor (6 seconds ago.)price 1699 (7 seconds ago.)ростовчан расстроил демонтаж арт-объекта на кировском (8 seconds ago.)xbbin (9 seconds ago.)var row (10 seconds ago.)codigo radio renault (10 seconds ago.)братья райт фильм (11 seconds ago.)silke (11 seconds ago.)al carritovista (12 seconds ago.)doppelstegplatten (13 seconds ago.)gateway loans (14 seconds ago.)turbobit premium indirme (16 seconds ago.)братья райт биография (16 seconds ago.)братья райт тула (17 seconds ago.)братья райт книга (18 seconds ago.)братья райт магазин (20 seconds ago.)home 7 (20 seconds ago.)братья райт (23 seconds ago.)忘记密码 ig (23 seconds ago.)0 0 6px (24 seconds ago.)братья райт жуковский (25 seconds ago.)misssmartyjones twitter (26 seconds ago.)братья райт википедия (26 seconds ago.)derz (26 seconds ago.)