Seafight.nl Favicon Seafight.nl

Seafight.nl Website Thumbnail
Checking...
Seafight | The adventure for sailors and pirates
Low trust score
 | 
Add a review Change category Claim this site
Join the infamous pirate-infested oceans and get ready to terrorize the seas. ✰ Battle your foes and join clans to become a legendary pirate! √


Domain summary

Domain label
seafight
Domain extension
nl
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is seafight.nl ranked relative to other sites:

Percentage of visits to seafight.nl from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Seafight.nl registered?
A: Seafight.nl was registered 1 week, 3 days, 10 hours, 37 minutes, 34 seconds ago on Tuesday, September 15, 2020.
Q: When was the WHOIS for Seafight.nl last updated?
A: The WHOIS entry was last updated 1 week, 3 days, 10 hours, 37 minutes, 34 seconds ago on Tuesday, September 15, 2020.
Q: What are Seafight.nl's nameservers?
A: DNS for Seafight.nl is provided by the following nameservers:
  • ns-842.awsdns-41.net
  • ns-269.awsdns-33.com
  • ns-1062.awsdns-04.org
  • ns-1618.awsdns-10.co.uk
Q: Who is the registrar for the Seafight.nl domain?
A: The domain has been registered at Stichting Internet Domeinregistratie NL.
Q: What is the traffic rank for Seafight.nl?
A: Seafight.nl has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Seafight.nl each day?
A: Seafight.nl receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Seafight.nl resolve to?
A: Seafight.nl resolves to the IPv4 address 178.132.241.130.
Q: In what country are Seafight.nl servers located in?
A: Seafight.nl has servers located in the Germany.
Q: What webserver software does Seafight.nl use?
A: Seafight.nl is powered by Nginx/1.10.3 (Ubuntu) webserver.
Q: Who hosts Seafight.nl?
A: Seafight.nl is hosted by BIGPOINT GmbH in Germany.
Q: How much is Seafight.nl worth?
A: Seafight.nl has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Seafight.nl?

Seafight.nl Hosting Provider Information

Hosted IP Address:178.132.241.130
Hosted Hostname:178.132.241.130
Service Provider:BIGPOINT GmbH
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:nginx/1.10.3 (Ubuntu)

Is "BIGPOINT GmbH" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Seafight.nl

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Server: nginx/1.10.3 (Ubuntu)
Date: Tue, 15 Sep 2020 11:36:21 GMT
Content-Type: text/html
Content-Length: 194
Connection: keep-alive
Location: https://www.seafight.com/?originalURL=seafight.nl&

Seafight.nl Domain Nameserver Information

HostIP AddressCountry
ns-842.awsdns-41.net 205.251.195.74
ns-269.awsdns-33.com 205.251.193.13
ns-1062.awsdns-04.org 205.251.196.38
ns-1618.awsdns-10.co.uk 205.251.198.82


Need to find out who hosts Seafight.nl?


WhoIs information for Seafight.nl

 Domain name: seafight.nl
Status: active

Registrar:
Domain Robot
Johanna-Dachs-Str. 55
93055 REGENSBURG
Germany

Abuse Contact:

Creation Date: 2006-10-18

Updated Date: 2019-10-18

DNSSEC: no

Domain nameservers:
ns-842.awsdns-41.net
ns-269.awsdns-33.com
ns-1062.awsdns-04.org
ns-1618.awsdns-10.co.uk

Record maintained by: NL Domain Registry

As the registrant's address is not in the Netherlands, the registrant is
obliged by the General Terms and Conditions for .nl Registrants to use
SIDN's registered office address as a domicile address. More information
on the use of a domicile address may be found at
https://www.sidn.nl/downloads/procedures/Domicile_address.pdf

Copyright notice
No part of this publication may be reproduced, published, stored in a
retrieval system, or transmitted, in any form or by any means,
electronic, mechanical, recording, or otherwise, without prior
permission of the Foundation for Internet Domain Registration in the
Netherlands (SIDN).
These restrictions apply equally to registrars, except in that
reproductions and publications are permitted insofar as they are
reasonable, necessary and solely in the context of the registration
activities referred to in the General Terms and Conditions for .nl
Registrars.
Any use of this material for advertising, targeting commercial offers or
similar activities is explicitly forbidden and liable to result in legal
action. Anyone who is aware or suspects that such activities are taking
place is asked to inform the Foundation for Internet Domain Registration
in the Netherlands.
(c) The Foundation for Internet Domain Registration in the Netherlands
(SIDN) Dutch Copyright Act, protection of authors' rights (Section 10,
subsection 1, clause 1).

Seafight.nl Free SEO Report

Website Inpage Analysis for Seafight.nl

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

2 :

Total Images

9 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

25:
  1. No text
    http://seafight.nl/GameAPI.php?action=portal.redirectToBoard
  2. Deutsch
    http://seafight.nl/?locale=de
  3. English
    http://seafight.nl/?locale=en
  4. Français
    http://seafight.nl/?locale=fr
  5. Italiano
    http://seafight.nl/?locale=it
  6. Español
    http://seafight.nl/?locale=es
  7. Русский
    http://seafight.nl/?locale=ru
  8. Turkçe
    http://seafight.nl/?locale=tr
  9. Česky
    http://seafight.nl/?locale=cs
  10. Polski
    http://seafight.nl/?locale=pl
  11. Nederlands
    http://seafight.nl/?locale=nl
  12. Slovensky
    http://seafight.nl/?locale=sk
  13. Română
    http://seafight.nl/?locale=ro
  14. Български
    http://seafight.nl/?locale=bg
  15. Magyar
    http://seafight.nl/?locale=hu
  16. Ελληνικά
    http://seafight.nl/?locale=el
  17. English
    http://seafight.nl/?locale=us
  18. Suomi
    http://seafight.nl/?locale=fi
  19. Português
    http://seafight.nl/?locale=pt
  20. Dansk
    http://seafight.nl/?locale=da
  21. Svenska
    http://seafight.nl/?locale=sv
  22. Norsk
    http://seafight.nl/?locale=no
  23. Português Brasileiro
    http://seafight.nl/?locale=br
  24. Support
    http://seafight.nl/index.es?action=externalSupport
  25. Forum
    http://seafight.nl/GameAPI.php?action=portal.redirectToBoard

Links - Internal (nofollow)

0:

Links - Outbound

12:
  1. Forgot your password?
    https://accountcenter.bpsecure.com/PasswordReminder?pid=14&lang=en
  2. No text
    https://www.facebook.com/dialog/oauth?client_id=355206115967&redirect_uri=https%3A%2F%2Fwww.seafight.com%2FProjectApi%2FFacebookConnect&scope=email%2Cuser_birthday&state=%7B%22authUser%22%3A14%2C%22token%22%3A%22Uo0zIBGnmJING6iyjy5UfZ_zsoynQXnzERVFC2XZNdTqWfnGXwv1sb5uV52vupTNNKUsGL3wDxRUnT0pPd7Vw2HNTYSBaogBbj88kx2R0XwbjO9kTyUwciiXU6hHKeBbs42GVtf76j-CavtscoDPa3k1GtSakL1aah4oOzr00ax80dg9Qe59S_Zc9zzeuG_XVWoCR8XG-OT7OfMlfmQDsPnW-LmVsqXRl6zf8WHUNV-eZddesYA4CJU-W6fan5cGzTCdPx6hY_9Q9x3ZAjwZV6bzggB85O1Nhxbd5x6YlJoaVx6rP9bPRMTcigTs16SyTHWzonlhyhntb8UHwhxTIXzEqf_4fOXEH-E74HdQnHDkfmxLvsjw2eRukcSkn1sTI1Q9CC5ciJfVKe1h0x7kSM_fE2jUo64xEsmnDz1F28DjIXqo7F9zaTjh4pkkKohCLXSYHCNdZ33TGNKhY2GjGb861NIdWeJzoOho8pPqARfC4sZeeG2-vBXZjzeRu1x2tlY5x1eIhrAUcdvW2hgRwzxmOwJlKqmzKf0x8k0Zej9J_L8%22%7D
  3. No text
    https://www.facebook.com/seafight
  4. No text
    https://www.twitter.com/seafight
  5. No text
    https://www.youtube.com/seafighthq
  6. Terms & Conditions
    https://legal.bigpoint.com/terms-and-conditions/
  7. Data Privacy Policy
    https://legal.bigpoint.com/privacy-policy/
  8. No text
    https://www.youtube.com/user/seafighthq
  9. Terms & Conditions
    https://legal.bigpoint.com/GB/terms-and-conditions/en
  10. No text
    https://www.bigpoint.net/
  11. Data Privacy Policy
    https://legal.bigpoint.com/GB/privacy-policy/en
  12. Legal information
    https://legal.bigpoint.com/GB/imprint/en

Links - Outbound (nofollow)

0:

Keyword Cloud for Seafight.nl

gameusernameplease enterwhich hascharacters this usernamenew passwordbuttonseasyour usernamepassword is toogames0 varfunctioncalledpolicypasswordbetweenplease enter yourdatayour shipnew password whichnbspnbspwhichpiratelong please chooseadventuredata privacy4ship4 and 20username is tooprivacy policylong pleasechoose a newcharacters the password0pleasenotcharacters please3ifhas between 4falsedata privacy policyshort pleaseconditionsonecharactersgb varallenglishnew username whichusername which haschoosebetween 4has betweenusername whichhasbecomeshort please choosepassword whichlongonlineprivacynewaddressseafight4 and 45browseryoutoo longpassword which hasterms20 charactersemailemail addressyour passwordterms conditionstoo long pleaseentervartoo short2please choosegbyournew usernametoo short pleaseenter yourfiletoo45 characterswhich has between1short

Longtail Keyword Density for Seafight.nl

KeywordsOccurences
which has between8
choose a new8
has between 48
please enter your6
username is too4
4 and 454
short please choose4
new username which4
username which has4
4 and 204
too short please4
too long please4
long please choose4
password is too4
new password which4
password which has4
characters this username3
characters the password3
data privacy policy3
please enter9
has between8
please choose8
between 48
which has8
0 var7
enter your6
username which4
new password4
e-mail address4
your password4
45 characters4
20 characters4
password which4
short please4
new username4
long please4
too long4
too short4
your username3
characters please3
terms conditions3
data privacy3
privacy policy3
your ship3
gb var3
var27
your26
please22
password17
username16
characters12
if11
new11
which10
you10
09
function9
enter9
too8
18
between8
has8
choose8
pirate7
all7
nbspnbsp7
online7
seafight5
game5
e-mail5
button5
become4
seas4
address4
false4
ship4
24
long4
34
short4
games4
called3
one3
gb3
data3
adventure3
43
policy3
privacy3
conditions3
terms3
not3
english3
browser3
file3

Seafight.nl Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Seafight.nl is a scam?

Websites with Similar Names

Seafieldandtribe.com
seafieldandtribe.com
Seafieldapartments.com
Gordon Nelson | Gordon Nelson is now Nelson Investments Inc. and Gordon Enterprises
Seafieldholiday.com
seafieldholiday.co.za is almost here!
Seafieldhotel.com
Seafield Hotel & Spa Resort | 4 Star Hotel in Wexford
Seafieldhouse.xyz
Seafield House Hotel – Brighton, Hove
Seafieldsclub.com
Sea Fields Club Delray
Seafieldservices.com
Website Temporarily Unavailable
Seafieldsproperty.co.uk
Isle of Wight Estate Agents & Property Experts | Seafields

Recently Updated Websites

Loopgoo.com 2 seconds ago.Bitdragongames.com 2 seconds ago.Bartpe.ru 3 seconds ago.Crownba.com 3 seconds ago.U-seek.co.uk 3 seconds ago.Frozenpanda.com 3 seconds ago.Oscar.com 3 seconds ago.Unihub-uk.com 4 seconds ago.Sodiumhealth.org 5 seconds ago.Xn--alo-vera-d1a.com 5 seconds ago.Tekbyus.com 6 seconds ago.Heidibollum.com 6 seconds ago.Stall13.com 6 seconds ago.Offthewallgifts.com 6 seconds ago.Ericagannett.com 7 seconds ago.Custom-effects.com 8 seconds ago.Growrichempire.com 8 seconds ago.Instanttrafficcommissions.com 8 seconds ago.Bioheatonline.com 8 seconds ago.Nhlcenter.com 9 seconds ago.Felinspourlautre.com 9 seconds ago.Mobilepeerawards.com 9 seconds ago.Jmdentaldds.com 10 seconds ago.Pediatria.ro 10 seconds ago.4realwomen.com 10 seconds ago.Habibiainstitute.org 11 seconds ago.Tolinforsentate.com 11 seconds ago.Uzbek-travel.com 11 seconds ago.Droletconstruction.com 11 seconds ago.Brooklynbasketballmuseum.org 11 seconds ago.