Select Sport

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet



Domain summary

Last updated
2020-12-09
Domain label
select-sport
Domain extension
lt
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is select-sport.lt ranked relative to other sites:

Percentage of visits to select-sport.lt from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Select-sport.lt registered?
A: Select-sport.lt was registered 4 months, 1 week, 5 days, 16 hours, 25 minutes, 52 seconds ago on Wednesday, December 9, 2020.
Q: When was the WHOIS for Select-sport.lt last updated?
A: The WHOIS entry was last updated 4 months, 1 week, 5 days, 16 hours, 25 minutes, 52 seconds ago on Wednesday, December 9, 2020.
Q: What are Select-sport.lt's nameservers?
A: DNS for Select-sport.lt is provided by the following nameservers:
  • ns1.interdata.lt
  • ns2.interdata.lt
Q: Who is the registrar for the Select-sport.lt domain?
A: The domain has been registered at .
Q: What is the traffic rank for Select-sport.lt?
A: Select-sport.lt has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Select-sport.lt each day?
A: Select-sport.lt receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Select-sport.lt resolve to?
A: Select-sport.lt resolves to the IPv4 address 79.98.24.131.
Q: In what country are Select-sport.lt servers located in?
A: Select-sport.lt has servers located in the Lithuania.
Q: What webserver software does Select-sport.lt use?
A: Select-sport.lt is powered by Apache/2 webserver.
Q: Who hosts Select-sport.lt?
A: Select-sport.lt is hosted by UAB Rakrejus in Republic Of Lithuania.
Q: How much is Select-sport.lt worth?
A: Select-sport.lt has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Select-sport.lt Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Select-sport.lt Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Select-sport.lt

H1 Headings

9 :
  1. FREE
  2. SELECT
  3. Futsal
  4. money back
  5. SELECT
  6. SELECT
  7. Goalkeeper
  8. Training
  9. Select Sport

H2 Headings

20 :
  1. Delivery
  2. Footballs
  3. balls
  4. guarantee
  5. Handballs
  6. Profcare
  7. gloves
  8. accesories
  9. SELECT Futsal Super (FIFA Quality Pro)
  10. SELECT BALL NET (14-16 balls)
  11. SELECT Futsal Master (IMS APPROVED)
  12. SELECT Kinezio Tape PROFCARE K, Red
  13. SELECT BALL-PUNKTUR
  14. Winter set: Hat + gloves + neck scarf
  15. SELECT suit ARGENTINA TRAINING SWEAT 1/2 ZIP, size: M, L, XL,
  16. Training elastic mini band Select Profcare
  17. SELECT Profcare BLISTER PLASTER
  18. Football SELECT Match DB FIFA Quality PRO (5 size)
  19. SELECT PLASTER
  20. Goalkeeper Gloves SELECT 03 Youth

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

59 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-69198229-2

Links - Internal

84:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Select-sport.lt

shopnet3px 12px 0pxguardsresistance 50cm xinlinetrue html1injuriesaddclothingfoamtrainingcomfortablespotquality proball net12px3returnfocusfalsewidth58meshopapprovalmaxwidth780px height70 openfalseairpriceresistanceterms amp conditionsfutsal100 polyesteraccesoriesfalsewidth58 maxwidth780px height70returnfocusfalse fixed trueperfect2pxrel colorboxglovezipfootballsfifawide rangecolorbox5 sizecurrent of totalfit685 23342select profcareglovesstock pricehtml true width58special offerstotal selectcartavailability in stocksportsyoursore5resistance 50cmnbsp selectheight70 openfalse returnfocusfalse7training accesoriesqualitycurrentimprovedhtmltotalfreeampplastermaterialvarsweatoffers for teamstitleterms ampx1416 ballsmaxwidth780pxrel colorbox inlinetruetraining clothingshop now3px 12pxproductsmadergba50true50cm370 685 23342teamweargoalkeeper glovesinsidewidth58 maxwidth780pxcooling productsconditionsfixed trueapproved12px 0pxtrue title false12px 0px rgba50height70selectfutsal balls14160circulation2px 2px 2pxcolorbox inlinetrue html2kaunas 370fifa qualitytrue titleprovidesproballstockinlinetruefixed true titleshopping cartdocumentreadyfunctionspecialred50 50compression8matchimsmaxwidth780px height70useinlinetrue html truecontact usrel0px rgba50 50ballsrgba50 50offerswidecontact4currentproduct currentopenfalsesupportsdelivery6nbspsporttitle falsehtml truesizeeasy92px 2pxustrue width58 maxwidth780pxelasticatedcurrentproductltbagsorderrange370 685polyester3pxskintermsamp conditions50cm xshoppingcolorbox inlinetrueinformationcontrolmusclesgoodensures14 workinoptimaldaysprofcaretapeteamsdevelopedopenfalse returnfocusfalse fixedgoalkeeperopenfalse returnfocusfalsehandballsheight70 openfalsepuadd to cartworkin days14 workin daysprotectstapescooling0px rgba50fifa quality prosmallkaunas 370 685cart documentreadyfunctionrgba50 50 50medicalmedical bagsreturnfocusfalse fixednowfixed0pxkaunasavailabilityims approvedbladderneopreneaccountselect futsalworkintrue width58

Longtail Keyword Density for Select-sport.lt

KeywordsOccurences
add to cart24
height70 openfalse returnfocusfalse12
fixed true title12
availability in stock12
current of total12
rel colorbox inlinetrue12
colorbox inlinetrue html12
inlinetrue html true12
html true width5812
true width58 maxwidth780px12
width58 maxwidth780px height7012
maxwidth780px height70 openfalse12
true title false12
openfalse returnfocusfalse fixed12
returnfocusfalse fixed true12
fifa quality pro7
2px 2px 2px6
14 workin days4
offers for teams4
terms amp conditions4
kaunas 370 6853
370 685 233423
resistance 50cm x3
3px 12px 0px3
12px 0px rgba503
0px rgba50 503
rgba50 50 503
2px 2px12
rel colorbox12
stock price12
currentproduct current12
title false12
true title12
fixed true12
returnfocusfalse fixed12
openfalse returnfocusfalse12
height70 openfalse12
maxwidth780px height7012
width58 maxwidth780px12
true width5812
inlinetrue html12
colorbox inlinetrue12
html true12
cart documentreadyfunction11
fifa quality8
total select8
quality pro7
shop now6
ims approved5
select profcare5
training accesories5
special offers4
nbsp select4
amp conditions4
select futsal4
futsal balls4
workin days4
14 workin4
14-16 balls4
training clothing4
terms amp4
ball net4
50cm x3
resistance 50cm3
100 polyester3
3px 12px3
12px 0px3
0px rgba503
rgba50 503
50 503
370 6853
contact us3
kaunas 3703
685 233423
cooling products3
medical bags3
wide range3
goalkeeper gloves3
5 size3
shopping cart3
select29
true28
cart27
add24
training20
2px18
balls17
false17
ball15
total12
inlinetrue12
price12
documentreadyfunction12
rel12
colorbox12
stock12
current12
width5812
maxwidth780px12
availability12
openfalse12
returnfocusfalse12
fixed12
title12
currentproduct12
height7012
html12
clothing12
quality10
x9
gloves9
futsal8
fifa8
size8
nbsp8
plaster7
accesories7
pro7
profcare7
polyester6
approved6
06
shop6
now6
16
var6
information6
26
36
supports6
teams6
teamwear6
material5
resistance5
us5
range5
ims5
ensures5
tape5
days5
goalkeeper5
bags5
conditions5
special5
m5
45
net4
14-164
sweat4
terms4
use4
zip4
easy4
account4
perfect4
sore4
muscles4
optimal4
provides4
amp4
handballs4
54
workin4
guards4
0px4
offers4
sport4
glove4
skin4
contact4
64
match4
circulation3
3px3
protects3
rgba503
12px3
e-shop3
elasticated3
spot3
small3
fit3
50cm3
good3
foam3
lt3
injuries3
73
sports3
cooling3
products3
compression3
neoprene3
medical3
tapes3
83
free3
wide3
footballs3
your3
93
comfortable3
kaunas3
order3
delivery3
improved3
developed3
pu3
control3
bladder3
inside3
air3
approval3
made3
red3
shopping3

Who hosts Select-sport.lt?

Select-sport.lt Hosting Provider Information

Hosted IP Address:79.98.24.131
Hosted Hostname:469920.s.dedikuoti.lt
Service Provider:UAB Rakrejus
Hosted Country:LithuaniaLT
Location Latitude:56
Location Longitude:24
Webserver Software:Apache/2

Is "UAB Rakrejus" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
UAB Rakrejus
0.0323%

HTTP Header Analysis for Select-sport.lt

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 09 Dec 2020 12:51:39 GMT
Server: Apache/2
X-Powered-By: PHP/5.5.28
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Length: 13113
Content-Type: text/html; charset=utf-8

Select-sport.lt Domain Nameserver Information

HostIP AddressCountry
ns1.interdata.lt 193.200.125.2Lithuania Lithuania
ns2.interdata.lt 193.200.125.9Lithuania Lithuania


Need to find out who hosts Select-sport.lt?


Domain Registration (WhoIs) information for Select-sport.lt

Websites with Similar Names

Selec-clothing.com
SELEC | Clothing company
Selec-temp.com
Temp Agency in Eugene & Portland Oregon | Selectemp
Selec.by
Рыбхоз Селец | Рыбхоз Селец
Selec.cl
Selec Chile – Soluciones Eléctricas
Selec.com.mx
403 - Prohibido: acceso denegado.
Selec.jp
莉吝床蟶ゅ
Selec.ru
Selec.ru - Электротехнический b2b портал
Selec.xyz
selec.xyz - Registered at Namecheap.com
Selec2or.info
selEC2or.info

Recently Updated Websites

Coolworkshirts.com (1 second ago.)Laplayadebelen.org (1 second ago.)Brixtastingroom.com (2 seconds ago.)Happybirthdaycakedesign.com (3 seconds ago.)Dandoelroll.com (4 seconds ago.)Stopmotionmontreal.com (4 seconds ago.)Tradewindaerialimaging.com (6 seconds ago.)Burkartgroup.com (6 seconds ago.)Minterai.com (6 seconds ago.)Compassion.org.pe (6 seconds ago.)Lenelanghoff.com (6 seconds ago.)Jaiacreations.com (6 seconds ago.)Haniachmielowska.com (7 seconds ago.)Garant154.ru (8 seconds ago.)Milasbirligimgida.com (8 seconds ago.)Krogercurbside.com (8 seconds ago.)Bookingceo.com (8 seconds ago.)Arenasports.bet (9 seconds ago.)Osomstudio.pl (9 seconds ago.)Greenandawake.com (10 seconds ago.)Iadance4joy.com (10 seconds ago.)Sullysurloire.com (10 seconds ago.)Gassankanko.jp (10 seconds ago.)Petalpushersflorist.net (11 seconds ago.)Usaforks.com (11 seconds ago.)Agario.fr (12 seconds ago.)Your-companimal.com (12 seconds ago.)Boatupholsterydanapointharbor.com (12 seconds ago.)Teacupsally.com (12 seconds ago.)Amberfavreart.com (12 seconds ago.)

Recently Searched Keywords

just (2 seconds ago.)bibapp (8 seconds ago.)enerji (16 seconds ago.)1x10 actual size (20 seconds ago.)sun (30 seconds ago.)markasizler (33 seconds ago.)altooamirror (34 seconds ago.)why to enjoy every moment with bangalore companion escorts girl (42 seconds ago.)rose (46 seconds ago.)esp-world (52 seconds ago.)lcd (53 seconds ago.)224 leather (53 seconds ago.)cng (54 seconds ago.)you get (56 seconds ago.)you also (58 seconds ago.)8 800 (1 minute ago.)7 days (1 minute 2 seconds ago.)宜宾 (1 minute 3 seconds ago.)02122020 - (1 minute 4 seconds ago.)3 6 (1 minute 5 seconds ago.)2 opacity (1 minute 6 seconds ago.)width 80 (1 minute 15 seconds ago.)canoe (1 minute 15 seconds ago.)mfredat ile (1 minute 18 seconds ago.)1x10^6 (1 minute 22 seconds ago.)1x10 lumber (1 minute 23 seconds ago.)diy (1 minute 23 seconds ago.)tại sao khách hàng tin tưởng lựa chọn dịch vụ của du lịch khát vọng việt (1 minute 25 seconds ago.)8 couples (1 minute 27 seconds ago.)inclusao financeira brasil (1 minute 27 seconds ago.)