sep.26

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet



Domain summary

Last updated
2021-05-20
Domain label
sep-26
Domain extension
paris
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Sep-26.paris registered?
A: Sep-26.paris was registered 4 months, 4 days, 21 hours, 55 minutes, 8 seconds ago on Thursday, May 20, 2021.
Q: When was the WHOIS for Sep-26.paris last updated?
A: The WHOIS entry was last updated 4 months, 4 days, 21 hours, 55 minutes, 8 seconds ago on Thursday, May 20, 2021.
Q: What are Sep-26.paris's nameservers?
A: DNS for Sep-26.paris is provided by the following nameservers:
  • ns19.ovh.net
  • dns19.ovh.net
Q: Who is the registrar for the Sep-26.paris domain?
A: The domain has been registered at .
Q: What is the traffic rank for Sep-26.paris?
A: Sep-26.paris has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Sep-26.paris each day?
A: Sep-26.paris receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Sep-26.paris resolve to?
A: Sep-26.paris resolves to the IPv4 address 23.227.38.32.
Q: In what country are Sep-26.paris servers located in?
A: Sep-26.paris has servers located in the Canada.
Q: What webserver software does Sep-26.paris use?
A: Sep-26.paris is powered by CloudFlare webserver.
Q: Who hosts Sep-26.paris?
A: Sep-26.paris is hosted by Shopify, Inc. in Canada.
Q: How much is Sep-26.paris worth?
A: Sep-26.paris has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Sep-26.paris Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Sep-26.paris Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Sep-26.paris

H1 Headings

1 :
  1. Your Cart

H2 Headings

1 :
  1. Opening Soon

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

2 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-143421396-1

Links - Internal (nofollow)

0:

Keyword Cloud for Sep-26.paris

fontfamilyitc caslon nofontfamily avenirfunctionnext fontweightcaslon no 224email1usfontdisplayfontweight 700newitc caslonsrcnext fontweight 700no 224400 fontstylenosep26truefontweight 400formatwoff2fontstylenew dategettimeelse iffalseitcfontdisplay swapcaslonenterfontstyle normal fontdisplayfontfacenormal fontdisplayfontweight 400 fontstyle2fontweightscriptfontstyle normalfontdisplay swap srcnext700 fontstylefontfamily avenir nextformatwoff400 fontstyle normal3formatwoff fontfaceelsefontweight 700 fontstylewinboomrlavenirffffffdategettimeswap srccaslon noformatwoff fontface fontfamilyswapnext fontweight 4004cartnormal fontdisplay swapavenir nextvaravenir next fontweightfontface fontfamilynormalif0fontface fontfamily avenirenabledyour

Longtail Keyword Density for Sep-26.paris

KeywordsOccurences
font-display swap src8
formatwoff font-face font-family7
font-style normal font-display6
normal font-display swap6
font-face font-family avenir6
font-family avenir next6
avenir next font-weight6
font-weight 400 font-style5
400 font-style normal4
itc caslon no3
caslon no 2243
next font-weight 4003
next font-weight 7003
font-weight 700 font-style3
font-face font-family8
avenir next8
font-display swap8
swap src8
formatwoff font-face7
normal font-display6
font-family avenir6
next font-weight6
font-style normal6
font-weight 4005
400 font-style5
new dategettime4
font-weight 7003
else if3
no 2243
caslon no3
itc caslon3
700 font-style3
if11
normal10
09
19
font-style8
font-family8
font-weight8
swap8
src8
formatwoff28
formatwoff8
true8
font-face8
avenir8
next8
font-display8
your7
ffffff6
var6
cart5
else5
false5
new4
function4
dategettime4
24
33
sep263
us3
email3
winboomrl3
script3
43
enabled3
itc3
caslon3
no3
enter3

Who hosts Sep-26.paris?

Sep-26.paris Hosting Provider Information

Hosted IP Address:23.227.38.32
Hosted Hostname:23.227.38.32
Service Provider:Shopify, Inc.
Hosted Country:CanadaCA
Location Latitude:43.6319
Location Longitude:-79.3716
Webserver Software:CloudFlare

Is "Shopify, Inc." in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.4810%
Unknown
8.7814%
AS-26496-GO-DADDY-COM-LLC
4.6042%
NAMECHEAP-NET
3.7023%
AMAZON-AES
2.7678%
GoDaddy.com, LLC
2.4095%
UNIFIEDLAYER-AS-1
2.4018%
Fara Negar Pardaz Khuzestan
2.0303%
CONFLUENCE-NETWORK-INC
1.7535%
1&1 Internet AG
1.6915%
Shopify, Inc.
0.9667%

HTTP Header Analysis for Sep-26.paris

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 20 May 2021 11:08:31 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Sorting-Hat-PodId: 84
X-Sorting-Hat-ShopId: 6806700117
X-Storefront-Renderer-Rendered: 1
X-Robots-Tag: nofollow
ETag: cacheable:9c076c68659b8fd2ad08991451ba1a34
X-Alternate-Cache-Key: cacheable:ea1f7fb0ad19265e7a14f11f3927ee20
Content-Encoding: gzip
X-Cache: miss
X-Frame-Options: DENY
Content-Security-Policy: block-all-mixed-content; frame-ancestors 'none'; upgrade-insecure-requests;
Strict-Transport-Security: max-age=7889238
X-ShopId: 6806700117
X-ShardId: 84
Vary: Accept
Content-Language: en
X-Shopify-Stage: production
X-Dc: gcp-us-central1,gcp-us-central1,gcp-us-central1
X-Request-ID: 97bed0e0-38e8-4561-96b8-0bcbd3fcdfd2
X-Content-Type-Options: nosniff
X-Permitted-Cross-Domain-Policies: none
X-XSS-Protection: 1; mode=block
X-Download-Options: noopen
NEL: {"report_to":"network-errors","max_age":2592000,"success_fraction":0.0001}
Report-To: {"group":"network-errors","max_age":2592000,"endpoints":[{"url":"https://monorail-edge.shopifysvc.com/v1/reports/nel/20190325/shopify"}]}
CF-Cache-Status: DYNAMIC
cf-request-id: 0a2b0f899c00005416d43dc000000001
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Server: cloudflare
CF-RAY: 65251b88ff945416-LHR
alt-svc: h3-27=":443"; ma=86400, h3-28=":443"; ma=86400, h3-29=":443"; ma=86400

Sep-26.paris Domain Nameserver Information

HostIP AddressCountry
ns19.ovh.net 213.251.128.139
dns19.ovh.net 213.251.188.139


Need to find out who hosts Sep-26.paris?


Domain Registration (WhoIs) information for Sep-26.paris

 Domain Name: sep-26.paris
Registry Domain ID: DOM000004203889-PARIS
Registrar WHOIS Server: whois.ovh.com
Registrar URL: http://www.ovh.com
Updated Date: 2020-08-01T08:10:46Z
Creation Date: 2019-08-28T15:55:36Z
Registry Expiry Date: 2021-08-28T15:55:36Z
Registrar: OVH
Registrar IANA ID: 433
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +33 9 72 10 10 07
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: REDACTED FOR PRIVACY
Registrant Name: REDACTED FOR PRIVACY
Registrant Organization: Unlicensed
Registrant Street: REDACTED FOR PRIVACY
Registrant City: REDACTED FOR PRIVACY
Registrant Postal Code: REDACTED FOR PRIVACY
Registrant Country: FR
Registrant Phone: REDACTED FOR PRIVACY
Registrant Fax: REDACTED FOR PRIVACY
Registrant Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Admin ID: REDACTED FOR PRIVACY
Admin Name: REDACTED FOR PRIVACY
Admin Organization: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin City: REDACTED FOR PRIVACY
Admin State/Province: REDACTED FOR PRIVACY
Admin Postal Code: REDACTED FOR PRIVACY
Admin Country: REDACTED FOR PRIVACY
Admin Phone: REDACTED FOR PRIVACY
Admin Fax: REDACTED FOR PRIVACY
Admin Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Tech ID: REDACTED FOR PRIVACY
Tech Name: REDACTED FOR PRIVACY
Tech Organization: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech City: REDACTED FOR PRIVACY
Tech State/Province: REDACTED FOR PRIVACY
Tech Postal Code: REDACTED FOR PRIVACY
Tech Country: REDACTED FOR PRIVACY
Tech Phone: REDACTED FOR PRIVACY
Tech Fax: REDACTED FOR PRIVACY
Tech Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Name Server: dns19.ovh.net
Name Server: ns19.ovh.net
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2021-05-20T11:08:33Z

Websites with Similar Names

Recently Updated Websites

Gear-lab.org (8 seconds ago.)Mmxxhub.com (15 seconds ago.)Kansascityseoandcontent.com (15 seconds ago.)Autovero.cz (15 seconds ago.)Nitroballsandfitness.com (20 seconds ago.)Lunelite.com (20 seconds ago.)Hotelneda.com (22 seconds ago.)Klinkier.biz (27 seconds ago.)Votebyhand.org (28 seconds ago.)Japadu.tirol (30 seconds ago.)Matrixvisual.com (32 seconds ago.)Sixmoments.com (34 seconds ago.)Midwestoutdoorllc.com (36 seconds ago.)Thethinkcollective.com (39 seconds ago.)Mdvsupply.com (40 seconds ago.)Fortmyersbeachcf.com (42 seconds ago.)Metroconstructionindia.com (45 seconds ago.)Moneybag.com (46 seconds ago.)Blognet.site (49 seconds ago.)Retec-analytics.com (49 seconds ago.)Nawawibahrudin.com (50 seconds ago.)Urbantailsoc.com (53 seconds ago.)Eatnaturaleveryday.com (54 seconds ago.)Zoekhulpbijwerk.nl (1 minute ago.)Onedatacenteramerica.com (1 minute 3 seconds ago.)Sourcedluxury-auto.website (1 minute 3 seconds ago.)Suppletude.com (1 minute 3 seconds ago.)Loveyourblackskin.com (1 minute 4 seconds ago.)Husbandrape.com (1 minute 6 seconds ago.)Allurespasuwanee.com (1 minute 11 seconds ago.)

Recently Searched Keywords

krystal webb (1 second ago.)otcbb (1 second ago.)tarona.net yangi mp3 (2 seconds ago.)mistakes are proof that you are trying (3 seconds ago.)reynolds video (3 seconds ago.)luyen pham dpm (4 seconds ago.)formserialize (5 seconds ago.)medisin (5 seconds ago.)nhu cu mua (6 seconds ago.)заявка (6 seconds ago.)hentai-fr (7 seconds ago.)молитва оптинских старцев (8 seconds ago.)luyen pham tishman speyer (8 seconds ago.)luyen pham haas (9 seconds ago.)yang didanai oleh uang jackpot yang tidak digunakan dari ruang poker tertutup (9 seconds ago.)projects case (9 seconds ago.)goodcap (10 seconds ago.)deutschland 86 (11 seconds ago.)для мочеполовой системы (11 seconds ago.)все квартиры (12 seconds ago.)position bottom (12 seconds ago.)2 common misconceptions (12 seconds ago.)mpo4d (12 seconds ago.)dr luyen pham (14 seconds ago.)larosas (14 seconds ago.)future studio arad (15 seconds ago.)not a lemmingnot a lemmingnot a lemmingnot a lemming (16 seconds ago.)phạm luyến (16 seconds ago.)renault-me (17 seconds ago.)praca w miastach (18 seconds ago.)