Sexvid.xxx Favicon Sexvid.xxx

Sexvid.xxx Website Thumbnail
Checking...
SexVid XXX - HD Sex Videos, Porn Tube Movies, Free Porno
Low trust score
 | 
Add a review Change category Claim this site
SexVid.xxx is the prime place for all of your HD porn needs! Massive collection of porno videos in lots of different niches.


Domain summary

Domain label
sexvid
Domain extension
xxx
Domain registered:
2013-05-28
Domain updated:
2020-10-11
Global Traffic Rank
63,455
Statvoo Rating
G
Trust Score
Low Trust Score
Estimated worth
$239,760
Estimated daily income
$333
Estimated monthly income
$10,129

Rank summary

How is sexvid.xxx ranked relative to other sites:

Percentage of visits to sexvid.xxx from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Sexvid.xxx registered?
A: Sexvid.xxx was registered 7 years, 5 months, 1 day, 5 hours, 21 minutes, 59 seconds ago on Tuesday, May 28, 2013.
Q: When was the WHOIS for Sexvid.xxx last updated?
A: The WHOIS entry was last updated 2 weeks, 4 days, 5 hours, 21 minutes, 59 seconds ago on Sunday, October 11, 2020.
Q: What are Sexvid.xxx's nameservers?
A: DNS for Sexvid.xxx is provided by the following nameservers:
  • ns1.sexvid.xxx
  • ns2.sexvid.xxx
Q: Who is the registrar for the Sexvid.xxx domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Sexvid.xxx?
A: Sexvid.xxx ranks 63,455 globally on Alexa. Sexvid.xxx has a Low Trust Score, and a Statvoo Rank of G.
Q: How many people visit Sexvid.xxx each day?
A: Sexvid.xxx receives approximately 27,736 visitors and 166,416 page impressions per day.
Q: What IP address does Sexvid.xxx resolve to?
A: Sexvid.xxx resolves to the IPv4 address 162.251.108.60.
Q: In what country are Sexvid.xxx servers located in?
A: Sexvid.xxx has servers located in the United States.
Q: What webserver software does Sexvid.xxx use?
A: Sexvid.xxx is powered by Nginx webserver.
Q: Who hosts Sexvid.xxx?
A: Sexvid.xxx is hosted by Hostiserver Ltd in Arizona, Phoenix, United States, 85034.
Q: How much is Sexvid.xxx worth?
A: Sexvid.xxx has an estimated worth of $239,760. An average daily income of approximately $333, which is roughly $10,129 per month.

Who hosts Sexvid.xxx?

Sexvid.xxx Hosting Provider Information

Hosted IP Address:162.251.108.60
Hosted Hostname:hs0199.hostiserver.com
Service Provider:Hostiserver Ltd
Hosted Country:United StatesUS
Location Latitude:33.4413
Location Longitude:-112.0421
Webserver Software:nginx

Is "Hostiserver Ltd" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Sexvid.xxx

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Server: nginx
Date: Sun, 11 Oct 2020 20:36:16 GMT
Content-Type: text/html
Content-Length: 162
Connection: keep-alive
Location: https://www.sexvid.xxx/
Strict-Transport-Security: max-age=63072000;

Sexvid.xxx Domain Nameserver Information

HostIP AddressCountry
ns1.sexvid.xxx 162.251.108.36
ns2.sexvid.xxx 162.251.110.28


Need to find out who hosts Sexvid.xxx?


WhoIs information for Sexvid.xxx

 Domain Name: sexvid.xxx
Registry Domain ID: D1205743-AGRS
Registrar WHOIS Server: whois.evonames.com
Registrar URL: www.evonames.com
Updated Date: 2020-03-21T00:03:38.196Z
Creation Date: 2013-05-28T08:52:54.435Z
Registry Expiry Date: 2021-05-28T08:52:54.435Z
Registrar: Danesco Trading Ltd.
Registrar IANA ID: 1418
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.5144959001
Domain Status: ok https://icann.org/epp#ok
Registry Registrant ID: REDACTED FOR PRIVACY
Registrant Name: REDACTED FOR PRIVACY
Registrant Organization: DANESCO TRADING LTD.
Registrant Street: REDACTED FOR PRIVACY
Registrant City: REDACTED FOR PRIVACY
Registrant State/Province:
Registrant Postal Code: REDACTED FOR PRIVACY
Registrant Country: CY
Registrant Phone: REDACTED FOR PRIVACY
Registrant Fax: REDACTED FOR PRIVACY
Registrant Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Admin ID: REDACTED FOR PRIVACY
Admin Name: REDACTED FOR PRIVACY
Admin Organization: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin City: REDACTED FOR PRIVACY
Admin State/Province: REDACTED FOR PRIVACY
Admin Postal Code: REDACTED FOR PRIVACY
Admin Country: REDACTED FOR PRIVACY
Admin Phone: REDACTED FOR PRIVACY
Admin Fax: REDACTED FOR PRIVACY
Admin Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Tech ID: REDACTED FOR PRIVACY
Tech Name: REDACTED FOR PRIVACY
Tech Organization: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech City: REDACTED FOR PRIVACY
Tech State/Province: REDACTED FOR PRIVACY
Tech Postal Code: REDACTED FOR PRIVACY
Tech Country: REDACTED FOR PRIVACY
Tech Phone: REDACTED FOR PRIVACY
Tech Fax: REDACTED FOR PRIVACY
Tech Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Billing ID: REDACTED FOR PRIVACY
Billing Name: REDACTED FOR PRIVACY
Billing Organization: REDACTED FOR PRIVACY
Billing Street: REDACTED FOR PRIVACY
Billing City: REDACTED FOR PRIVACY
Billing State/Province: REDACTED FOR PRIVACY
Billing Postal Code: REDACTED FOR PRIVACY
Billing Country: REDACTED FOR PRIVACY
Billing Phone: REDACTED FOR PRIVACY
Billing Fax: REDACTED FOR PRIVACY
Billing Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Name Server: ns2.sexvid.xxx
Name Server: ns1.sexvid.xxx
DNSSEC: unsigned
URL of the ICANN RDDS Inaccuracy Complaint Form: https://www.icann.org/wicf/

>>> Last update of WHOIS database: 2020-05-18T22:34:30.732Z

Sexvid.xxx Free SEO Report

Website Inpage Analysis for Sexvid.xxx

H1 Headings

1 :
  1. Today's Featured XXX Movies

H2 Headings

7 :
  1. Most Viewed Videos This Month
  2. Top Categories
  3. Hottest Porn Pictures
  4. Featured Pornstars
  5. Top Channels
  6. Top Searches
  7. Recommended

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

76 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-54359353-1

Links - Internal

152:
  1. Deutsch
    https://de.sexvid.xxx/
  2. No text
    https://www.sexvid.xxx/
  3. Home
    https://www.sexvid.xxx/
  4. Videos
    https://www.sexvid.xxx/p/
  5. Photos
    https://www.sexvid.xxx/photos/
  6. Categories
    https://www.sexvid.xxx/c/
  7. Pornstars
    https://www.sexvid.xxx/pornstars/
  8. Channels
    https://www.sexvid.xxx/sponsor/
  9. Community
    https://www.sexvid.xxx/community/
  10. Live Sex
    https://www.sexvid.xxx/?action=trace&id=798463
  11. Curvy starlet is shown as she is making a hot and sexy porn video 4 years ago 235.3M 6:25
    https://www.sexvid.xxx/curvy-starlet-is-shown-as-she-is-making-a-hot-and-sexy-porn-video.html
  12. Sexy schoolgirl is getting undressed and is getting fucked hard 4 years ago 357.7M 7:50
    https://www.sexvid.xxx/sexy-schoolgirl-is-getting-undressed-and-is-getting-fucked-hard.html
  13. A curvy woman in lingerie gets a dick inside her wet pussy lips 4 years ago 435.6M 6:14
    https://www.sexvid.xxx/a-curvy-woman-in-lingerie-gets-a-dick-inside-her-wet-pussy-lips.html
  14. A busty thing that has a big ass is getting fucked in the office 4 years ago 210.1M 7:10
    https://www.sexvid.xxx/a-busty-thing-that-has-a-big-ass-is-getting-fucked-in-the-office.html
  15. Dillion Harper having anal sex and getting fed with sperm 6 years ago 301.1M 9:03
    https://www.sexvid.xxx/dillion-harper-having-anal-sex-and-getting-fed-with-sperm.html
  16. Hot woman helps her daughter with her boyfriend in a threesome 4 years ago 274.5M 7:05
    https://www.sexvid.xxx/hot-woman-helps-her-daughter-with-her-boyfriend-in-a-threesome.html
  17. This pretty couple knows how to perform a crazy sexual action 4 years ago 226.8M 6:57
    https://www.sexvid.xxx/this-pretty-couple-knows-how-to-perform-a-crazy-sexual-action.html
  18. Gorgeous MILF lady Vanilla DeVille sucking a big dick in POV 4 years ago 317.7M 6:51
    https://www.sexvid.xxx/gorgeous-milf-lady-vanilla-deville-sucking-a-big-dick-in-pov.html
  19. Prada XXX giving nice head and getting harshly smacked 6 years ago 260.7M 7:01
    https://www.sexvid.xxx/prada-xxx-giving-nice-head-and-getting-harshly-smacked.html
  20. A hot ebony woman is opening up her cunt for some loving 3 years ago 158.2M 7:00
    https://www.sexvid.xxx/a-hot-ebony-woman-is-opening-up-her-cunt-for-some-loving.html
  21. Most Favourited
    https://www.sexvid.xxx/p/most-favourited/
  22. Latest
    https://www.sexvid.xxx/p/date/
  23. Longest
    https://www.sexvid.xxx/p/duration/
  24. Most Viewed
    https://www.sexvid.xxx/p/
  25. Most Commented
    https://www.sexvid.xxx/p/most-commented/
  26. Top Rated
    https://www.sexvid.xxx/p/rating/
  27. Couple uses the obedient young girl as furniture and sex partner 2 hours ago 242 7:54
    https://www.sexvid.xxx/couple-uses-the-obedient-young-girl-as-furniture-and-sex-partner.html
  28. Porn video where the busty Latina turns virgins into real men 4 hours ago 663 8:00
    https://www.sexvid.xxx/porn-video-where-the-busty-latina-turns-virgins-into-real-men.html
  29. Girl in sneakers touches cock making man go hard for sex 5 hours ago 397 8:05
    https://www.sexvid.xxx/girl-in-sneakers-touches-cock-making-man-go-hard-for-sex.html
  30. Getting surprised by older man's big dick girl gets bonked 6 hours ago 890 8:00
    https://www.sexvid.xxx/getting-surprised-by-older-man-s-big-dick-girl-gets-bonked.html
  31. A bunch of restless lesbians fuck each other during group sex 7 hours ago 620 8:00
    https://www.sexvid.xxx/a-bunch-of-restless-lesbians-fuck-each-other-during-group-sex.html
  32. Nothing makes the dark-haired babe happier than anal penetration 7 hours ago 695 8:00
    https://www.sexvid.xxx/nothing-makes-the-dark-haired-babe-happier-than-anal-penetration.html
  33. Petite blonde with small tits sucks and rides BF's thick cock 8 hours ago 292 8:10
    https://www.sexvid.xxx/petite-blonde-with-small-tits-sucks-and-rides-bf-s-thick-cock.html
  34. Compilation in which men swap stepdaughters and fuck them 9 hours ago 1641 7:50
    https://www.sexvid.xxx/compilation-in-which-men-swap-stepdaughters-and-fuck-them.html
  35. Mulatto with huge tits and tushy is penetrated by stepbrother 10 hours ago 1411 8:00
    https://www.sexvid.xxx/mulatto-with-huge-tits-and-tushy-is-penetrated-by-stepbrother.html
  36. Flexible cuties worship each other's sweet pussy in empty gym 11 hours ago 3697 8:10
    https://www.sexvid.xxx/flexible-cuties-worship-each-other-s-sweet-pussy-in-empty-gym.html
  37. Guy's fantasy about sex with stepmother finally becomes reality 12 hours ago 3367 8:00
    https://www.sexvid.xxx/guy-s-fantasy-about-sex-with-stepmother-finally-becomes-reality.html
  38. Confident moves of MILF make stepson give up and penetrate her 13 hours ago 4140 7:54
    https://www.sexvid.xxx/confident-moves-of-milf-make-stepson-give-up-and-penetrate-her.html
  39. Girl spreads legs for the nerd compensating for slutty girlfriend 14 hours ago 9543 7:58
    https://www.sexvid.xxx/girl-spreads-legs-for-the-nerd-compensating-for-slutty-girlfriend.html
  40. Teen proves skills to bald guy who finishes test with facial 14 hours ago 19K 7:56
    https://www.sexvid.xxx/teen-proves-skills-to-bald-guy-who-finishes-test-with-facial.html
  41. Brunette sucks penis and makes it vaginally with perfect lover 15 hours ago 14K 8:00
    https://www.sexvid.xxx/brunette-sucks-penis-and-makes-it-vaginally-with-perfect-lover.html
  42. Voodoo works perfectly and makes lesbians lick pussies on couch 16 hours ago 4750 8:08
    https://www.sexvid.xxx/voodoo-works-perfectly-and-makes-lesbians-lick-pussies-on-couch.html
  43. Girl fondles cock with mouth and then gets face-fucked hard 18 hours ago 4497 7:54
    https://www.sexvid.xxx/girl-fondles-cock-with-mouth-and-then-gets-face-fucked-hard.html
  44. Vibrator is an excellent gift for the curvaceous soon-to-be wife 18 hours ago 7413 8:02
    https://www.sexvid.xxx/vibrator-is-an-excellent-gift-for-the-curvaceous-soon-to-be-wife.html
  45. Filthy guy torments cheating fuck because it makes girl cum 18 hours ago 5269 4:00
    https://www.sexvid.xxx/filthy-guy-torments-cheating-fuck-because-it-makes-girl-cum.html
  46. Hunny is fucked so heavily in mouth and cherry for money 18 hours ago 30K 8:00
    https://www.sexvid.xxx/hunny-is-fucked-so-heavily-in-mouth-and-cherry-for-money.html
  47. Helpful stepdad shaved girl's pussy and drills it with dick 20 hours ago 20K 8:06
    https://www.sexvid.xxx/helpful-stepdad-shaved-girl-s-pussy-and-drills-it-with-dick.html
  48. Fired employee hires the bandit to fuck boss' stepdaughter 20 hours ago 613 7:55
    https://www.sexvid.xxx/fired-employee-hires-the-bandit-to-fuck-boss-stepdaughter.html
  49. Petite chick blackmailed into taboo sex with stepbrother 22 hours ago 449 8:00
    https://www.sexvid.xxx/petite-chick-blackmailed-into-taboo-sex-with-stepbrother.html
  50. Boy and stepmother are totally out of mind getting it on 22 hours ago 719 8:00
    https://www.sexvid.xxx/boy-and-stepmother-are-totally-out-of-mind-getting-it-on.html
  51. Ex-boyfriend spanks the poor girl and fucks her from behind 22 hours ago 2384 7:57
    https://www.sexvid.xxx/ex-boyfriend-spanks-the-poor-girl-and-fucks-her-from-behind.html
  52. Big-boobied Codi Vore plays with tits and fucks herself 23 hours ago 584 8:05
    https://www.sexvid.xxx/big-boobied-codi-vore-plays-with-tits-and-fucks-herself.html
  53. Fetching blonde rewards boyfriend with anal sex on camera 1 day ago 2247 8:00
    https://www.sexvid.xxx/fetching-blonde-rewards-boyfriend-with-anal-sex-on-camera.html
  54. Asian teen and stunning MILF drilled by pool guy outdoors 1 day ago 695 8:04
    https://www.sexvid.xxx/asian-teen-and-stunning-milf-drilled-by-pool-guy-outdoors.html
  55. MILF with tattooed body is tied up and bonked by handsome guy 1 day ago 782 8:07
    https://www.sexvid.xxx/milf-with-tattooed-body-is-tied-up-and-bonked-by-handsome-guy.html
  56. MILF wanted to have a BDSM threesome with hubby and another girl 1 day ago 831 4:00
    https://www.sexvid.xxx/milf-wanted-to-have-a-bdsm-threesome-with-hubby-and-another-girl.html
  57. show more
    https://www.sexvid.xxx/c/
  58. 9319 Anal
    https://www.sexvid.xxx/c/anal/
  59. 1178 Double Penetration
    https://www.sexvid.xxx/c/double-penetration/
  60. 7776 Teens
    https://www.sexvid.xxx/c/teens/
  61. 4001 Threesomes
    https://www.sexvid.xxx/c/threesomes/
  62. 6 Bisexual
    https://www.sexvid.xxx/c/bisexual/
  63. 2167 Big Boobs
    https://www.sexvid.xxx/c/big-boobs/
  64. 28987 Blowjobs
    https://www.sexvid.xxx/c/blowjobs/
  65. 16043 Brunettes
    https://www.sexvid.xxx/c/brunettes/
  66. 3712 MILFs
    https://www.sexvid.xxx/c/milfs/
  67. 18 Upskirts
    https://www.sexvid.xxx/c/upskirts/
  68. show more
    https://www.sexvid.xxx/photos/
  69. Lovely teen Sandra Luberc is alone at home and can freely fool around naked 2 hours ago 105 16
    https://www.sexvid.xxx/photos/lovely-teen-sandra-luberc-is-alone-at-home-and-can-freely-fool-around-naked/
  70. Barbie girl in pink clothes embarrassingly takes off her panties on the chair 3 hours ago 576 15
    https://www.sexvid.xxx/photos/barbie-girl-in-pink-clothes-embarrassingly-takes-off-her-panties-on-the-chair/
  71. Bald pornographer is mad about blonde babe and strips her to be carnal 3 hours ago 492 15
    https://www.sexvid.xxx/photos/bald-pornographer-is-mad-about-blonde-babe-and-strips-her-to-be-carnal/
  72. Blonde massage therapist getting naked before her client is coming 6 hours ago 426 15
    https://www.sexvid.xxx/photos/blonde-massage-therapist-getting-naked-before-her-client-is-coming/
  73. Nice girl shows shaved pussy sitting on a suspended chair by the window 6 hours ago 482 15
    https://www.sexvid.xxx/photos/nice-girl-shows-shaved-pussy-sitting-on-a-suspended-chair-by-the-window/
  74. Handsome man impales and facializes smoking-hot Euro model on his yacht 8 hours ago 1581 13
    https://www.sexvid.xxx/photos/handsome-man-impales-and-facializes-smoking-hot-euro-model-on-his-yacht/
  75. show more
    https://www.sexvid.xxx/pornstars/
  76. Angelica Heart 80% 20
    https://www.sexvid.xxx/pornstars/angelica-heart/
  77. Angelin Joy 93% 25
    https://www.sexvid.xxx/pornstars/angelin-joy/
  78. Hollie Mack 83% 16
    https://www.sexvid.xxx/pornstars/hollie-mack/
  79. Emma Brown 84% 31
    https://www.sexvid.xxx/pornstars/emma-brown/
  80. Zazie Skymm 86% 39
    https://www.sexvid.xxx/pornstars/zazie-skymm/
  81. Casey Calvert 78% 163
    https://www.sexvid.xxx/pornstars/casey-calvert/
  82. show more
    https://www.sexvid.xxx/sponsor/
  83. 4685 Brazzers
    https://www.sexvid.xxx/sponsor/brazzers/
  84. 4263 Evil Angel
    https://www.sexvid.xxx/sponsor/evil-angel/
  85. 2551 Devil's Film
    https://www.sexvid.xxx/sponsor/devilsfilm/
  86. 1677 21 Sextury
    https://www.sexvid.xxx/sponsor/21-sextury/
  87. 1350 Wicked
    https://www.sexvid.xxx/sponsor/wicked/
  88. xxx video film indian hd sexy choot kali choot indian
    https://www.sexvid.xxx/s/xxx+video+film+indian+hd+sexy+choot+kali+choot+indian/
  89. xxx full hindi video hindi sex h.d
    https://www.sexvid.xxx/s/xxx+full+hindi++video+hindi+sex+++h.d/
  90. indian
    https://www.sexvid.xxx/s/indian/
  91. hd 18 yar new girl xxx
    https://www.sexvid.xxx/s/hd+18+yar+new+girl+xxx/
  92. www com xxx video hindi full hd
    https://www.sexvid.xxx/s/www+com+xxx+video+hindi+full+hd/
  93. sunny leone sex video
    https://www.sexvid.xxx/s/sunny+leone++sex+video/
  94. xxx sex video com
    https://www.sexvid.xxx/s/xxx+sex+video+com/
  95. xxx hd video
    https://www.sexvid.xxx/s/xxx+hd+video/
  96. mom
    https://www.sexvid.xxx/s/mom/
  97. indian sex
    https://www.sexvid.xxx/s/indian+sex/
  98. w.w.sexy.opan.video.x.x.bf.com.
    https://www.sexvid.xxx/s/w.w.sexy.opan.video.x.x.bf.com./
  99. suny leone sax video
    https://www.sexvid.xxx/s/suny+leone+sax+video/
  100. xxx download free videos
    https://www.sexvid.xxx/s/xxx+download+free+videos/
  101. indian bhabhi
    https://www.sexvid.xxx/s/indian+bhabhi/
  102. indian aunty
    https://www.sexvid.xxx/s/indian+aunty/
  103. 18 yr virgen girl first time. painfully sex videos
    https://www.sexvid.xxx/s/18+yr+virgen+girl+first+time.+painfully+sex+videos/
  104. sleeping
    https://www.sexvid.xxx/s/sleeping/
  105. sleeping mom
    https://www.sexvid.xxx/s/sleeping+mom/
  106. 18 साल की लड़की सील पैक तोड़ते हुए वीडियो भेजो सेक्सी
    https://www.sexvid.xxx/s/18+%E0%A4%B8%E0%A4%BE%E0%A4%B2+%E0%A4%95%E0%A5%80+%E0%A4%B2%E0%A4%A1%E0%A4%BC%E0%A4%95%E0%A5%80+%E0%A4%B8%E0%A5%80%E0%A4%B2+%E0%A4%AA%E0%A5%88%E0%A4%95+%E0%A4%A4%E0%A5%8B%E0%A4%A1%E0%A4%BC%E0%A4%A4%E0%A5%87+%E0%A4%B9%E0%A5%81%E0%A4%8F+%E0%A4%B5%E0%A5%80%E0%A4%A1%E0%A4%BF%E0%A4%AF%E0%A5%8B+%E0%A4%AD%E0%A5%87%E0%A4%9C%E0%A5%8B+%E0%A4%B8%E0%A5%87%E0%A4%95%E0%A5%8D%E0%A4%B8%E0%A5%80/
  107. [email protected]
    https://www.sexvid.xxx/s/www.xxx.video.hd.%40com/
  108. indian girl
    https://www.sexvid.xxx/s/indian+girl/
  109. balding sex fast tim sex
    https://www.sexvid.xxx/s/balding+sex+fast+tim+sex/
  110. 18 year indian virgin
    https://www.sexvid.xxx/s/18+year+indian+virgin/
  111. sunny leone
    https://www.sexvid.xxx/s/sunny+leone/
  112. hot mom
    https://www.sexvid.xxx/s/hot+mom/
  113. 18 sal ki gerl xxxx videos
    https://www.sexvid.xxx/s/18+sal+ki+gerl+xxxx+videos/
  114. indian desi
    https://www.sexvid.xxx/s/indian+desi/
  115. mia khalifa
    https://www.sexvid.xxx/s/mia+khalifa/
  116. mom sex
    https://www.sexvid.xxx/s/mom+sex/
  117. desi indian
    https://www.sexvid.xxx/s/desi+indian/
  118. 18 साल की लड़की सील पैक तोड़ दिखाई देगा वीडियो भेजो अच्छा सेक्सी
    https://www.sexvid.xxx/s/18+%E0%A4%B8%E0%A4%BE%E0%A4%B2+%E0%A4%95%E0%A5%80+%E0%A4%B2%E0%A4%A1%E0%A4%BC%E0%A4%95%E0%A5%80+%E0%A4%B8%E0%A5%80%E0%A4%B2+%E0%A4%AA%E0%A5%88%E0%A4%95+%E0%A4%A4%E0%A5%8B%E0%A4%A1%E0%A4%BC+%E0%A4%A6%E0%A4%BF%E0%A4%96%E0%A4%BE%E0%A4%88+%E0%A4%A6%E0%A5%87%E0%A4%97%E0%A4%BE+%E0%A4%B5%E0%A5%80%E0%A4%A1%E0%A4%BF%E0%A4%AF%E0%A5%8B+%E0%A4%AD%E0%A5%87%E0%A4%9C%E0%A5%8B+%E0%A4%85%E0%A4%9A%E0%A5%8D%E0%A4%9B%E0%A4%BE+%E0%A4%B8%E0%A5%87%E0%A4%95%E0%A5%8D%E0%A4%B8%E0%A5%80/
  119. 2019 का सेक्सी वीडियो बीएफ हिंदी में फुल मूवी एचडी
    https://www.sexvid.xxx/s/2019+%E0%A4%95%E0%A4%BE+%E0%A4%B8%E0%A5%87%E0%A4%95%E0%A5%8D%E0%A4%B8%E0%A5%80+%E0%A4%B5%E0%A5%80%E0%A4%A1%E0%A4%BF%E0%A4%AF%E0%A5%8B+%E0%A4%AC%E0%A5%80%E0%A4%8F%E0%A4%AB+%E0%A4%B9%E0%A4%BF%E0%A4%82%E0%A4%A6%E0%A5%80+%E0%A4%AE%E0%A5%87%E0%A4%82+%E0%A4%AB%E0%A5%81%E0%A4%B2+%E0%A4%AE%E0%A5%82%E0%A4%B5%E0%A5%80+%E0%A4%8F%E0%A4%9A%E0%A4%A1%E0%A5%80/
  120. big boobs
    https://www.sexvid.xxx/s/big+boobs/
  121. 18 साल की लड़की सेक्स वीडियो
    https://www.sexvid.xxx/s/18+%E0%A4%B8%E0%A4%BE%E0%A4%B2+%E0%A4%95%E0%A5%80+%E0%A4%B2%E0%A4%A1%E0%A4%BC%E0%A4%95%E0%A5%80+%E0%A4%B8%E0%A5%87%E0%A4%95%E0%A5%8D%E0%A4%B8+%E0%A4%B5%E0%A5%80%E0%A4%A1%E0%A4%BF%E0%A4%AF%E0%A5%8B/
  122. brazzers
    https://www.sexvid.xxx/s/brazzers/
  123. फुल hd सेक्सी वीडियो बलात्कार वाला
    https://www.sexvid.xxx/s/%E0%A4%AB%E0%A5%81%E0%A4%B2+hd+%E0%A4%B8%E0%A5%87%E0%A4%95%E0%A5%8D%E0%A4%B8%E0%A5%80+%E0%A4%B5%E0%A5%80%E0%A4%A1%E0%A4%BF%E0%A4%AF%E0%A5%8B+%E0%A4%AC%E0%A4%B2%E0%A4%BE%E0%A4%A4%E0%A5%8D%E0%A4%95%E0%A4%BE%E0%A4%B0+%E0%A4%B5%E0%A4%BE%E0%A4%B2%E0%A4%BE/
  124. first time sex
    https://www.sexvid.xxx/s/first+time+sex/
  125. big ass
    https://www.sexvid.xxx/s/big+ass/
  126. slut doesn t make difference between husband and stepson when it comes to sex
    https://www.sexvid.xxx/s/slut+doesn+t+make+difference+between+husband+and+stepson+when+it+comes+to+sex/
  127. 18 से 2 साल की लड़की का ब्लू फिल्म फुल hd
    https://www.sexvid.xxx/s/18+%E0%A4%B8%E0%A5%87+2+%E0%A4%B8%E0%A4%BE%E0%A4%B2+%E0%A4%95%E0%A5%80+%E0%A4%B2%E0%A4%A1%E0%A4%BC%E0%A4%95%E0%A5%80+%E0%A4%95%E0%A4%BE+%E0%A4%AC%E0%A5%8D%E0%A4%B2%E0%A5%82+%E0%A4%AB%E0%A4%BF%E0%A4%B2%E0%A5%8D%E0%A4%AE+%E0%A4%AB%E0%A5%81%E0%A4%B2+hd/
  128. japanese
    https://www.sexvid.xxx/s/japanese/
  129. www.new hose wife reap exson xxx.com
    https://www.sexvid.xxx/s/www.new+hose+wife+reap+exson+xxx.com/
  130. russian teen couple has vaginal sex after oral foreplay on the camera
    https://www.sexvid.xxx/s/russian+teen+couple+has+vaginal+sex+after+oral+foreplay+on+the+camera/
  131. mom sleeping
    https://www.sexvid.xxx/s/mom+sleeping/
  132. stepmom
    https://www.sexvid.xxx/s/stepmom/
  133. 18 year old latina maid sophia leone gets fucked and creamed
    https://www.sexvid.xxx/s/18+year+old+latina+maid+sophia+leone+gets+fucked+and+creamed/
  134. gentle teen with pigtails and tiny tits gets fucked passionately by a guy
    https://www.sexvid.xxx/s/gentle+teen+with+pigtails+and+tiny+tits+gets+fucked+passionately+by+a+guy/
  135. 18 साल की लड़की का सेक्सी वीडियो सोती हुई का
    https://www.sexvid.xxx/s/18+%E0%A4%B8%E0%A4%BE%E0%A4%B2+%E0%A4%95%E0%A5%80+%E0%A4%B2%E0%A4%A1%E0%A4%BC%E0%A4%95%E0%A5%80+%E0%A4%95%E0%A4%BE+%E0%A4%B8%E0%A5%87%E0%A4%95%E0%A5%8D%E0%A4%B8%E0%A5%80+%E0%A4%B5%E0%A5%80%E0%A4%A1%E0%A4%BF%E0%A4%AF%E0%A5%8B+%E0%A4%B8%E0%A5%8B%E0%A4%A4%E0%A5%80+%E0%A4%B9%E0%A5%81%E0%A4%88+%E0%A4%95%E0%A4%BE/
  136. মা ছেলের চোদাচুদির xxx বাংলাদেশ বাংলা ভিডিও
    https://www.sexvid.xxx/s/%E0%A6%AE%E0%A6%BE+%E0%A6%9B%E0%A7%87%E0%A6%B2%E0%A7%87%E0%A6%B0+%E0%A6%9A%E0%A7%8B%E0%A6%A6%E0%A6%BE%E0%A6%9A%E0%A7%81%E0%A6%A6%E0%A6%BF%E0%A6%B0+xxx+%E0%A6%AC%E0%A6%BE%E0%A6%82%E0%A6%B2%E0%A6%BE%E0%A6%A6%E0%A7%87%E0%A6%B6+%E0%A6%AC%E0%A6%BE%E0%A6%82%E0%A6%B2%E0%A6%BE+%E0%A6%AD%E0%A6%BF%E0%A6%A1%E0%A6%BF%E0%A6%93/
  137. 18 साल की लड़की का बीएफ हिंदी में
    https://www.sexvid.xxx/s/18+%E0%A4%B8%E0%A4%BE%E0%A4%B2+%E0%A4%95%E0%A5%80+%E0%A4%B2%E0%A4%A1%E0%A4%BC%E0%A4%95%E0%A5%80+%E0%A4%95%E0%A4%BE+%E0%A4%AC%E0%A5%80%E0%A4%8F%E0%A4%AB+%E0%A4%B9%E0%A4%BF%E0%A4%82%E0%A4%A6%E0%A5%80+%E0%A4%AE%E0%A5%87%E0%A4%82/
  138. forced sex
    https://www.sexvid.xxx/s/forced+sex/
  139. sex indonesia full
    https://www.sexvid.xxx/s/sex+indonesia+full/
  140. forced
    https://www.sexvid.xxx/s/forced/
  141. desi
    https://www.sexvid.xxx/s/desi/
  142. brazzers mom
    https://www.sexvid.xxx/s/brazzers+mom/
  143. russian teen wants to try anal sex and trains asshole using a sex toy
    https://www.sexvid.xxx/s/russian+teen+wants+to+try+anal+sex+and+trains+asshole+using+a+sex+toy/
  144. step-mom
    https://www.sexvid.xxx/s/step-mom/
  145. 18 young girls english full movie
    https://www.sexvid.xxx/s/18+young+girls+english+full+movie/
  146. tamil aunty with young boy
    https://www.sexvid.xxx/s/tamil+aunty+with+young+boy/
  147. young lover fucks married milf with huge tits and erupts cum on her belly
    https://www.sexvid.xxx/s/young+lover+fucks+married+milf+with+huge+tits+and+erupts+cum+on+her+belly/
  148. Terms & Conditions
    https://www.sexvid.xxx/terms/
  149. 18 U.S.C. 2257
    https://www.sexvid.xxx/2257/
  150. Privacy Policy
    https://www.sexvid.xxx/policy/
  151. DMCA
    https://www.sexvid.xxx/dmca/
  152. Contact Us
    https://www.sexvid.xxx/support/

Links - Internal (nofollow)

6:
  1. Live Sex
    https://www.sexvid.xxx/?action=trace&id=798463
  2. Terms & Conditions
    https://www.sexvid.xxx/terms/
  3. 18 U.S.C. 2257
    https://www.sexvid.xxx/2257/
  4. Privacy Policy
    https://www.sexvid.xxx/policy/
  5. DMCA
    https://www.sexvid.xxx/dmca/
  6. Contact Us
    https://www.sexvid.xxx/support/

Links - Outbound

5:
  1. PornID
    https://www.pornid.xxx/?utm_source=sexvid&utm_medium=network-bar&utm_campaign=sexvid-networkbar
  2. ZBporn
    https://zbporn.com/?utm_source=sexvid&utm_medium=network-bar&utm_campaign=sexvid-networkbar
  3. HDTube.Porn
    https://www.hdtube.porn/?utm_source=sexvid&utm_medium=network-bar&utm_campaign=sexvid-networkbar
  4. Webmasters
    http://www.tubepartnership.com/
  5. Advertising
    http://www.tubepartnership.com/advertising/

Links - Outbound (nofollow)

2:
  1. Webmasters
    http://www.tubepartnership.com/
  2. Advertising
    http://www.tubepartnership.com/advertising/

Keyword Cloud for Sexvid.xxx

guy14woman4allneed1 day agovideoshours ago85leonetitsvisitorfreemorereturnthenfullanyblondefuckshouldtabcookiepromo18 hours10quality22 hoursinto1 daytrue ifshouldfirefunctionpumostdesiif typeofif shouldfireday agoreturn truepornhourscookiethemfindtopnullreturn true if18 hours agofucksgetdevicetypeofsexvidxxxconfigoverwritemanyhardothersleepingincrementcoupleshow morexxxclickebonybigispassingpromocheck9makessexy22 hours ago12hugeteenif clickgirlprefixyoung6 hours agopathfromcookieyourwindowlocationpathnamecomingcocktrue if clicktrueup66 hoursclicksclickedhotagopucookiegetpathcookienameundefinedmilfletnewhdgetclickspussydickyears agoherbrazzersgettingelsepathtimefirstyearsisnocheckcookiesetgetscategoriesmomanal sexload24 years agoindianfuckedifsomethinghindiispassingreferrercheck7analconfigoutcanmakeispurechromehave4 yearshas3urlcompletelycompletely freefalsesex0bestgetpromovaryou canwebsitevideo1311youshow1day

Longtail Keyword Density for Sexvid.xxx

KeywordsOccurences
4 years ago7
18 hours ago4
1 day ago4
6 hours ago3
22 hours ago3
return true if3
true if click3
hours ago32
years ago10
4 years7
if click5
true if4
show more4
day ago4
1 day4
18 hours4
return true4
22 hours3
you can3
completely free3
if typeof3
6 hours3
if shouldfire3
anal sex3
ago46
hours32
if29
sex25
function24
019
return19
you18
xxx13
girl13
let12
shouldfire11
click11
video11
111
her10
videos10
years10
210
var10
indian10
hd9
39
tab9
null8
more8
getting8
porn8
website6
mom6
46
milf6
teen6
big6
config6
typeof6
undefined6
path6
true6
have5
55
up5
full5
many5
all5
clicks5
guy5
prefix5
anal5
gets5
into5
fucked5
makes5
tits5
has5
64
getdevice4
top4
find4
hot4
young4
hard4
best4
dick4
cookie4
time4
free4
pussy4
make4
leone4
most4
can4
show4
then4
categories4
blonde4
fuck4
day4
pathfromcookie3
getpromo3
increment3
else3
cookiepromo3
getclicks3
windowlocationpathname3
ispassingpromocheck3
pucookiegetpathcookiename3
clicked3
configoverwrite3
false3
ispurechrome3
visitor3
sexy3
isnocheckcookieset3
ispassingreferrercheck3
should3
woman3
your3
url3
new3
huge3
73
them3
83
93
out3
fucks3
load3
103
brazzers3
other3
cock3
hindi3
first3
couple3
sleeping3
desi3
sexvidxxx3
113
123
quality3
something3
133
143
any3
need3
ebony3
completely3
pu3
coming3

Sexvid.xxx Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Websites with Similar Names

Sexviacam.com
Live SEX via CAM - All Webcam Sex Chat
Sexviacam.online
Meet a local Bitch tonight
Sexviacam.top
sexviacam.top - Registered at Namecheap.com
Sexvibes.com
The domain name sexvibes.com is for sale
Sexvicedaily.com
playmates of the month,Playboy Playmates galleries
Sexvicio.com
HugeDomains.com - SexVicio.com is for sale (Sex Vicio)
Sexvid.xxx
SexVid XXX - HD Sex Videos, Porn Tube Movies, Free Porno
Sexvidas.com
sexvidas.com

Recently Updated Websites

Prerov.eu 2 seconds ago.Spottydogdigitalmarketing.com 3 seconds ago.Alvintabios.com 3 seconds ago.Isnox.com 4 seconds ago.Tratoindia.com 4 seconds ago.Buyingyourfirsthome.xyz 5 seconds ago.Cpwh.com.tw 5 seconds ago.Hs-xx.com 5 seconds ago.2cyclecarbkit.com 6 seconds ago.Chiccouturedress.com 6 seconds ago.Taxiwordpress.com 6 seconds ago.Sbknyc.com 6 seconds ago.Pmfabrication.com 6 seconds ago.Olieverfschilderen.nl 6 seconds ago.Zebgolf.com 7 seconds ago.Gekizetsu.net 7 seconds ago.V88893.com 8 seconds ago.Thehaggertygroup.com 8 seconds ago.Instrchina.com 8 seconds ago.Websajt.cz 9 seconds ago.Qczfp.com 10 seconds ago.Johnnylleonard.com 10 seconds ago.Sydneymoon.com 10 seconds ago.Berrys.xyz 11 seconds ago.Calzadosbomba.com 11 seconds ago.Luxurydesigns.xyz 11 seconds ago.Gruposura.com 11 seconds ago.Dwgroup.asia 12 seconds ago.Eurekavideo.co.uk 12 seconds ago.Callblueribbon.com 13 seconds ago.