Smart Solutions in Graphites & Fiber Composites | SGL Carbon

Safety: Low trust score
Year Founded: 2000
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

As a specialist for graphite and fiber composite materials, SGL Carbon offers innovative and reliable solutions along the entire value chain.



Domain summary

Last updated
2021-09-19
Domain label
sgl-carbon
Domain extension
us
Domain registered:
2000-06-04
Domain updated:
2021-09-19
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Sgl-carbon.us registered?
A: Sgl-carbon.us was registered 21 years, 4 months, 2 weeks, 3 days, 15 hours, 17 minutes, 4 seconds ago on Sunday, June 4, 2000.
Q: When was the WHOIS for Sgl-carbon.us last updated?
A: The WHOIS entry was last updated 1 month, 2 days, 15 hours, 17 minutes, 4 seconds ago on Sunday, September 19, 2021.
Q: What are Sgl-carbon.us's nameservers?
A: DNS for Sgl-carbon.us is provided by the following nameservers:
  • ns-72.awsdns-09.com
  • ns-1548.awsdns-01.co.uk
  • ns-1260.awsdns-29.org
  • ns-803.awsdns-36.net
Q: Who is the registrar for the Sgl-carbon.us domain?
A: The domain has been registered at NEUSTAR INC..
Q: What is the traffic rank for Sgl-carbon.us?
A: Sgl-carbon.us has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Sgl-carbon.us each day?
A: Sgl-carbon.us receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Sgl-carbon.us resolve to?
A: Sgl-carbon.us resolves to the IPv4 address .
Q: In what country are Sgl-carbon.us servers located in?
A: Sgl-carbon.us has servers located in the .
Q: What webserver software does Sgl-carbon.us use?
A: Sgl-carbon.us is powered by Web webserver.
Q: Who hosts Sgl-carbon.us?
A: Sgl-carbon.us is hosted by Unknown in .
Q: How much is Sgl-carbon.us worth?
A: Sgl-carbon.us has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Sgl-carbon.us Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Sgl-carbon.us Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Sgl-carbon.us

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

18 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

100:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Sgl-carbon.us

carbonlightweightfindergeneralfirstmarketsampnewsour

Longtail Keyword Density for Sgl-carbon.us

KeywordsOccurences
amp10
carbon8
finder7
markets4
news4
general4
our3
lightweight3
first3

Who hosts Sgl-carbon.us?

Sgl-carbon.us Hosting Provider Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Unknown
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:web

Is "Unknown" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
15.4249%
Unknown
11.7059%
AS-26496-GO-DADDY-COM-LLC
4.1307%
NAMECHEAP-NET
3.3122%
AMAZON-AES
2.5118%
GoDaddy.com, LLC
2.1535%
UNIFIEDLAYER-AS-1
2.1315%
Fara Negar Pardaz Khuzestan
1.7839%
CONFLUENCE-NETWORK-INC
1.5636%
1&1 Internet AG
1.4878%

HTTP Header Analysis for Sgl-carbon.us

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Content-Type: text/html; charset=utf-8
Content-Length: 16036
Connection: keep-alive
Date: Sun, 19 Sep 2021 05:08:51 GMT
Server: web
Strict-Transport-Security: max-age=31536000
X-Content-Type-Options: nosniff
X-Frame-Options: SAMEORIGIN
X-XSS-Protection: 1; mode=block
X-Powered-By: PHP/7.1.33
Content-Language: en
Cache-Control: max-age=0, no-cache
Pragma: public
Content-Security-Policy: frame-ancestors 'self' https://sgl-live01.mcon-group.com https://logon.sglcarbon.com;
X-Mod-Pagespeed: 1.13.35.2-0
Content-Encoding: gzip
Access-Control-Allow-Origin: *
Access-Control-Allow-Headers: origin, x-requested-with, content-type
Access-Control-Allow-Methods: PUT, GET, POST, DELETE, OPTIONS
Referrer-Policy: same-origin
X-UA-Compatible: IE=edge
Vary: Host,Accept-Encoding
X-Cache: Miss from cloudfront
Via: 1.1 97aeedc9b20e15872c1d58120f2a7ae8.cloudfront.net (CloudFront)
X-Amz-Cf-Pop: LHR62-C1
X-Amz-Cf-Id: WrVXtNFN5MBVViOLvldlIj6fcbP261TkIBD0eD5EJJ7XzeKqPJTeSQ==

Sgl-carbon.us Domain Nameserver Information

HostIP AddressCountry
ns-72.awsdns-09.com 205.251.192.72
ns-1548.awsdns-01.co.uk 205.251.198.12
ns-1260.awsdns-29.org 205.251.196.236
ns-803.awsdns-36.net 205.251.195.35


Need to find out who hosts Sgl-carbon.us?


Domain Registration (WhoIs) information for Sgl-carbon.us

 Domain Name: sgl-carbon.us
Registry Domain ID: D12795706-US
Registrar WHOIS Server: whois.markmonitor.com
Registrar URL: www.markmonitor.com
Updated Date: 2021-05-07T09:10:34Z
Creation Date: 2007-06-04T17:20:42Z
Registry Expiry Date: 2023-06-03T23:59:59Z
Registrar: MarkMonitor, Inc.
Registrar IANA ID: 292
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.2083895740
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registry Registrant ID: C34431951-US
Registrant Name: Domain Manager
Registrant Organization: SGL Carbon SE
Registrant Street: Werner-von-Siemens-Str. 18
Registrant Street:
Registrant Street:
Registrant City: Meitingen
Registrant State/Province: Meitingen
Registrant Postal Code: 86405
Registrant Country: DE
Registrant Phone: +49.8271831833
Registrant Phone Ext:
Registrant Fax: +49.8271831830
Registrant Fax Ext:
Registrant Email: Login to show email
Application Purpose: P1
Registrant Nexus Category: C32/DE
Registry Admin ID:
Admin Name:
Admin Organization:
Admin Street:
Admin Street:
Admin Street:
Admin City:
Admin State/Province:
Admin Postal Code:
Admin Country:
Admin Phone:
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email:
Registry Tech ID: C53845086-US
Tech Name: Dan Johansson
Tech Organization: SGL Carbon SE
Tech Street: CBS Technology Team
Tech Street: Werner-von-Siemens-Str. 18
Tech Street:
Tech City: Meitingen
Tech State/Province: DE
Tech Postal Code: 86405
Tech Country: DE
Tech Phone: +49.827183333
Tech Phone Ext:
Tech Fax: +49.827183103333
Tech Fax Ext:
Tech Email: Login to show email
Server: ns-1260.awsdns-29.org
Name Server: ns-1548.awsdns-01.co.uk
Name Server: ns-72.awsdns-09.com
Name Server: ns-803.awsdns-36.net
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2021-09-19T05:08:52Z

Websites with Similar Names

Sgl-ca.com
Squares Global Logistics – Anything, Anytime, Anywhere
Sgl-carbon.us
Smart Solutions in Graphites & Fiber Composites | SGL Carbon

Recently Updated Websites

Workingworldwilde.com (1 second ago.)Lifters.xyz (2 seconds ago.)Kiraiiclothing.com (3 seconds ago.)Africanfoodforthesoul.com (5 seconds ago.)Stolencameras.com (6 seconds ago.)Viva-makelaars-winschoten.nl (7 seconds ago.)Image1.marktplatznet.de (7 seconds ago.)Whereworkingactorswork.com (8 seconds ago.)Couponsflex.com (8 seconds ago.)Harryergott.com (11 seconds ago.)Kaspersky.co.th (11 seconds ago.)Anythingtomp3.com (11 seconds ago.)Cicdirectory.com (12 seconds ago.)Songsongmeow-jp.com (13 seconds ago.)Holi.community (13 seconds ago.)Girishpatel.net (13 seconds ago.)Summerskillslax.com (13 seconds ago.)Smarter-documents.com (15 seconds ago.)Oyoza.com (15 seconds ago.)Gclarke.com (15 seconds ago.)Mm-pwr-u.com (16 seconds ago.)Chinchequineequipment.com (16 seconds ago.)Bxnmg77.com (17 seconds ago.)M8377.com (17 seconds ago.)Wwwufgpolicy.com (17 seconds ago.)Alpcoventures.com (19 seconds ago.)Losverdes1.com (20 seconds ago.)Alwinv.net (20 seconds ago.)Irncid.org (20 seconds ago.)Statco.org (21 seconds ago.)

Recently Searched Keywords

2001 2000 (3 seconds ago.)ufeff ufffd font-face (10 seconds ago.)ja nee (10 seconds ago.)ng helderberg (21 seconds ago.)hairy cunt (25 seconds ago.)trimmers (27 seconds ago.)n else (28 seconds ago.)市长信箱 (34 seconds ago.)wybierz ocen (36 seconds ago.)addounia tv (38 seconds ago.)hr consultancy (45 seconds ago.)poznań-akumulatory.pl (46 seconds ago.)agario (47 seconds ago.)morning sunrise (47 seconds ago.)txtv100 (47 seconds ago.)technical badhak (48 seconds ago.)undefeatable (48 seconds ago.)1500 return (56 seconds ago.)octans (1 minute 6 seconds ago.)new date (1 minute 11 seconds ago.)closing title (1 minute 13 seconds ago.)kopilot coffee (1 minute 30 seconds ago.)-2pxblack (1 minute 30 seconds ago.)shemale travesti porno star anal hart porno (1 minute 38 seconds ago.)bulut (1 minute 41 seconds ago.)partners get involved (1 minute 42 seconds ago.)shemale fuck girl tube (44) (1 minute 46 seconds ago.)boxing classes dubai (1 minute 47 seconds ago.)txxx.com (1 minute 54 seconds ago.)la fondation (1 minute 56 seconds ago.)