شکوفا الکتریک سرویس | شکوفا الکتریک سرویس

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: Unknown
Estimated Worth: $9



Domain summary

Last updated
2021-04-22
Domain label
shekofa
Domain extension
ir
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Shekofa.ir registered?
A: Shekofa.ir was registered 4 months, 4 weeks, 1 day, 19 hours, 43 minutes, 52 seconds ago on Thursday, April 22, 2021.
Q: When was the WHOIS for Shekofa.ir last updated?
A: The WHOIS entry was last updated 4 months, 4 weeks, 1 day, 19 hours, 43 minutes, 52 seconds ago on Thursday, April 22, 2021.
Q: What are Shekofa.ir's nameservers?
A: DNS for Shekofa.ir is provided by the following nameservers:
  • irns1.netafraz.com
  • irns2.netafraz.com
Q: Who is the registrar for the Shekofa.ir domain?
A: The domain has been registered at NIC-IR.
Q: What is the traffic rank for Shekofa.ir?
A: Shekofa.ir has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Shekofa.ir each day?
A: Shekofa.ir receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Shekofa.ir resolve to?
A: Shekofa.ir resolves to the IPv4 address 185.73.226.46.
Q: In what country are Shekofa.ir servers located in?
A: Shekofa.ir has servers located in the Iran.
Q: What webserver software does Shekofa.ir use?
A: Shekofa.ir is powered by Nginx webserver.
Q: Who hosts Shekofa.ir?
A: Shekofa.ir is hosted by Netafraz Iranian Ltd. in Iran.
Q: How much is Shekofa.ir worth?
A: Shekofa.ir has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Shekofa.ir Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Shekofa.ir Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Shekofa.ir

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

1 :
  1. سبد خرید

H4 Headings

0 :

H5 Headings

1 :
  1. تماس با ما

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

20 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

125:

Links - Outbound (nofollow)

9:

Keyword Cloud for Shekofa.ir

width 800pxjquery800pxhtmldivinnerhtml htmldivcsssubmenudropdown minheight 100pxhtmldivcss100px widthc4submenudropdownvar htmldivhtmldivinnerhtmlwpapifetchuse2errminheight 100px widthminheight 100pxlisticondocumentwritevardomainminheight3listicon colorhtmldivfunction1err errwidth100px width 800px0100pxsubmenudropdown minheightelsecolorrevinitrevslider46150pxoncerevslider461

Who hosts Shekofa.ir?

Shekofa.ir Hosting Provider Information

Hosted IP Address:185.73.226.46
Hosted Hostname:fwx.srv14.irwebspace.com
Service Provider:Netafraz Iranian Ltd.
Hosted Country:IranIR
Location Latitude:35.698
Location Longitude:51.4115
Webserver Software:nginx

Is "Netafraz Iranian Ltd." in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.4810%
Unknown
8.7814%
AS-26496-GO-DADDY-COM-LLC
4.6042%
NAMECHEAP-NET
3.7023%
AMAZON-AES
2.7678%
GoDaddy.com, LLC
2.4095%
UNIFIEDLAYER-AS-1
2.4018%
Fara Negar Pardaz Khuzestan
2.0303%
CONFLUENCE-NETWORK-INC
1.7535%
1&1 Internet AG
1.6915%
Netafraz Iranian Ltd.
0.0012%

HTTP Header Analysis for Shekofa.ir

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Thu, 22 Apr 2021 07:35:06 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 33062
Connection: keep-alive
Link:; rel="https://api.w.org/", ; rel="alternate"; type="application/json", ; rel=shortlink
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip

Shekofa.ir Domain Nameserver Information

HostIP AddressCountry
irns1.netafraz.com 185.78.22.2
irns2.netafraz.com 149.202.28.110


Need to find out who hosts Shekofa.ir?


Domain Registration (WhoIs) information for Shekofa.ir

 % This is the IRNIC Whois server v1.6.2.
% Available on web at http://whois.nic.ir/
% Find the terms and conditions of use on http://www.nic.ir/
%
% This server uses UTF-8 as the encoding for requests and responses.

% NOTE: This output has been filtered.

% Information related to 'shekofa.ir'

domain: shekofa.ir
ascii: shekofa.ir
remarks: (Domain Holder) Shekofa Electric Service Co., Co
remarks: (Domain Holder Address) Apt.2,No.364,Mirdamad Ave. ,bridge side,, Tehran, Tehran, IR
holder-c: sh1216-irnic
admin-c: sh1216-irnic
tech-c: sh1216-irnic
nserver: irns1.netafraz.com
nserver: irns2.netafraz.com
last-updated: 2021-03-06
expire-date: 2023-04-03
source: IRNIC # Filtered

nic-hdl: sh1216-irnic
org: Shekofa Electric Service Co., Co
e-mail: Login to show email
Apt.2,No.364,Mirdamad Ave. ,bridge side,, Tehran, Tehran, IR
phone: +98 21 22271593
fax-no: +98 21 22279353
source: IRNIC # Filtered

Websites with Similar Names

Sheko.properties
sheko.properties - Registered at Namecheap.com
Shekofa.ir
شکوفا الکتریک سرویس | شکوفا الکتریک سرویس
Shekofaland.com
HugeDomains.com
Shekofehblanket.ir
پتوی شکوفه
Shekoff.com
Зов Хранителя – Книга Олега Шеховцова
Shekoftehahmadi.com
آموزش طراحی - شکفته احمدی
Shekogaming.com
HugeDomains.com
Shekoi.com
The domain name shekoi.com is for sale

Recently Updated Websites

Ybty8843.com (1 second ago.)Goddess-jt.com (4 seconds ago.)Livedrumtracks.com (4 seconds ago.)Ricochetlounge.com (5 seconds ago.)Enexotomotiv.com (7 seconds ago.)Wspwheels.com (8 seconds ago.)Cliniquedutechnopole.com (8 seconds ago.)Kaprizovnet.net (8 seconds ago.)Theworldendeclipse.jp (9 seconds ago.)Theveggieculture.com (11 seconds ago.)Latelierdepierre69.com (11 seconds ago.)Caibet917.app (11 seconds ago.)Herimportsusa.com (11 seconds ago.)Thevictorytheatrecenter.org (11 seconds ago.)Millionairemindvibe.com (12 seconds ago.)Reihokumokuzai-kougyou.com (12 seconds ago.)Thebuildersreview.com (13 seconds ago.)Marcoautorepair.com (14 seconds ago.)Kingsource.ltd (14 seconds ago.)Covid20lies.com (17 seconds ago.)Wacooke.net (18 seconds ago.)Osiptel.kred (18 seconds ago.)Kotontekstil.com (20 seconds ago.)Pemfmasterclass.org (21 seconds ago.)Brasscomponents.co.uk (21 seconds ago.)Enlightenyourlovepath.com (22 seconds ago.)Laportescbd.com (23 seconds ago.)Drink-defense.com (24 seconds ago.)Leathertec.co.nz (25 seconds ago.)Greennmn.com (28 seconds ago.)

Recently Searched Keywords

cyberbird lyrics (1 second ago.)2 paa97coma (1 second ago.)контроллеры эра (1 second ago.)2020-12-10 8 2020-12-10 (1 second ago.)style-kgkl9mpvnavcontainerright-direction (1 second ago.)6 week (5 seconds ago.)web cam benidorm (5 seconds ago.)infocopyright copyright-areahide copyright-area (7 seconds ago.)tuesday wednesday thursday (8 seconds ago.)36 seri no.lu kdv tebliğ yayımlandı. (3.6.2021) (11 seconds ago.)chateau-bohemia (11 seconds ago.)scgen (12 seconds ago.)items w (13 seconds ago.)12. sınıf matematik (14 seconds ago.)bulma tabs (15 seconds ago.)tamil baby names (15 seconds ago.)audi a3 2015, двс tfsi 1,4 бензин б (15 seconds ago.)şok 3 mart 2021 aktüel ürünler kataloğu (15 seconds ago.)банковский юрист это (17 seconds ago.)é cliente profissional e quer melhorar suas vendas (19 seconds ago.)comparison table (19 seconds ago.)freshlook contact lenses dubai (21 seconds ago.)cần tuyển 4 : 3 nhân viên kinh doanh, 1 nhân viên kế toán (kiêm kinh doanh) (23 seconds ago.)マナ酵素ファスティングダイエットは意味ない? (24 seconds ago.)ctv edmonton: potential measles exposure (26 seconds ago.)be productive (31 seconds ago.)2014���Ϻ�վ (32 seconds ago.)dlouhá porno videa zdarma (34 seconds ago.)tiu ng (35 seconds ago.)1200x2000 1400x2000 (39 seconds ago.)