Экспресс Шиппинг Сервис - Комплексная Международная Логистика

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet



Domain summary

Last updated
2021-09-25
Domain label
shipping
Domain extension
ee
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Shipping.ee registered?
A: Shipping.ee was registered 3 weeks, 6 days, 13 hours, 58 minutes, 50 seconds ago on Saturday, September 25, 2021.
Q: When was the WHOIS for Shipping.ee last updated?
A: The WHOIS entry was last updated 3 weeks, 6 days, 13 hours, 58 minutes, 50 seconds ago on Saturday, September 25, 2021.
Q: What are Shipping.ee's nameservers?
A: DNS for Shipping.ee is provided by the following nameservers:
  • ns2.edss.ee
  • ns1.edss.ee
Q: Who is the registrar for the Shipping.ee domain?
A: The domain has been registered at .
Q: What is the traffic rank for Shipping.ee?
A: Shipping.ee has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Shipping.ee each day?
A: Shipping.ee receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Shipping.ee resolve to?
A: Shipping.ee resolves to the IPv4 address 188.92.160.13.
Q: In what country are Shipping.ee servers located in?
A: Shipping.ee has servers located in the Estonia.
Q: What webserver software does Shipping.ee use?
A: Shipping.ee is powered by Nginx webserver.
Q: Who hosts Shipping.ee?
A: Shipping.ee is hosted by Compic Ltd. in Estonia.
Q: How much is Shipping.ee worth?
A: Shipping.ee has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Shipping.ee Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Shipping.ee Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Shipping.ee

H1 Headings

1 :
  1. Международные перевозки из Азии и Европы

H2 Headings

9 :
  1. Импорт через порты СПБ и Таллин
  2. Перевозим и оформляем грузы
  3. Недовольны поставщиком
  4. или ищете лучшую ставку?
  5. О нас
  6. Услуги
  7. Галерея
  8. Контакт
  9. Следуйте за нами:

H3 Headings

4 :
  1. Мы сотрудничаем со всем крупнейшими контейнерными линиями
  2. Санкт-Петербург
  3. Таллинн
  4. Консультация логиста

H4 Headings

9 :
  1. Комплексная логистика
  2. Оптимизация ВЭД
  3. 2 порта – 2 входа
  4. Специальные грузы
  5. Свободная зона Мууга
  6. Негабарит
  7. Специальные грузы
  8. Свободная зона Мууга
  9. Негабарит

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

62 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

23:

Links - Outbound (nofollow)

0:

Keyword Cloud for Shipping.ee

data2var gmap6function eventvarwpcf7mailsent functionwpcf7mailsentnewfunction var372 6262 64map10830001730004u043du04300documentaddeventlistenerifwpcf7mailsent function eventdocumentaddeventlistener wpcf7mailsent functiondivgmap mapdivdatagmapgmapfunctioneventu043du0430 1u0438u043bu0438372 62 640 0mapdivdatagmapgmapgmapfalse3clustering0 0 0markersu0447u0442u043eu0431u044btrue5nulldocumentaddeventlistener wpcf7mailsentess

Who hosts Shipping.ee?

Shipping.ee Hosting Provider Information

Hosted IP Address:188.92.160.13
Hosted Hostname:h5.compic.ee
Service Provider:Compic Ltd.
Hosted Country:EstoniaEE
Location Latitude:59
Location Longitude:26
Webserver Software:nginx

Is "Compic Ltd." in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
15.4249%
Unknown
11.7059%
AS-26496-GO-DADDY-COM-LLC
4.1307%
NAMECHEAP-NET
3.3122%
AMAZON-AES
2.5118%
GoDaddy.com, LLC
2.1535%
UNIFIEDLAYER-AS-1
2.1315%
Fara Negar Pardaz Khuzestan
1.7839%
CONFLUENCE-NETWORK-INC
1.5636%
1&1 Internet AG
1.4878%
Compic Ltd.
0.0003%

HTTP Header Analysis for Shipping.ee

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Sat, 25 Sep 2021 22:13:08 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 17722
Connection: keep-alive
X-Powered-By: PHP/7.2.34
Vary: Accept-Encoding,Cookie,User-Agent
Cache-Control: max-age=604800
Content-Encoding: gzip
Expires: Sat, 02 Oct 2021 22:13:08 GMT

Shipping.ee Domain Nameserver Information

HostIP AddressCountry
ns2.edss.ee 88.196.163.224
ns1.edss.ee 217.159.186.253


Need to find out who hosts Shipping.ee?


Domain Registration (WhoIs) information for Shipping.ee

 The information obtained through .ee WHOIS is subject to database
protection according to the Estonian Copyright Act and international
conventions. All rights are reserved to Estonian Internet Foundation.
Search results may not be used for commercial, advertising,
recompilation, repackaging, redistribution, reuse, obscuring or other
similar activities. Downloading of information about domain names for the
creation of your own database is not permitted. If any of the information
from .ee WHOIS is transferred to a third party, it must be done in its
entirety. This server must not be used as a backend for a search engine.
Read more about the Rules of .ee WHOIS service:
https://www.internet.ee/domains/whois-terms-and-conditions.

Estonia .ee Top Level Domain WHOIS server

Domain:
name: shipping.ee
status: ok (paid and in zone)
registered: 2010-07-04 05:17:46 +03:00
changed: 2019-11-18 16:07:05 +02:00
expire: 2020-12-04
outzone:
delete:

Registrant:
name: EXPRESS SHIPPING SERVICE OU
org id: 10410650
country: EE
email: Not Disclosed - Visit www.internet.ee for webbased WHOIS
changed: 2019-11-18 16:07:05 +02:00

Administrative contact:
name: Not Disclosed - Visit www.internet.ee for webbased WHOIS
email: Not Disclosed - Visit www.internet.ee for webbased WHOIS
changed: Not Disclosed - Visit www.internet.ee for webbased WHOIS

Technical contact:
name: Not Disclosed - Visit www.internet.ee for webbased WHOIS
email: Not Disclosed - Visit www.internet.ee for webbased WHOIS
changed: Not Disclosed - Visit www.internet.ee for webbased WHOIS

Registrar:
name: AS Infonet
url: http://www.infonet.ee
phone: +372 640 0000
changed: 2020-09-07 11:15:01 +03:00

Name servers:
nserver: ns2.edss.ee
nserver: ns1.edss.ee
changed: 2016-10-27 15:09:28 +03:00

Estonia .ee Top Level Domain WHOIS server
More information at http://internet.ee

Websites with Similar Names

Shipp-das.com
Index of /
Shipp-logistics.com
Motor Carrier - Shipp Logistics LLC
Shipp-roofing.com
英亚体育-英亚体育彩票,英亚体育官网地址
Shipp.co
shipp.co
Shipp.com
RealNames | A more meaningful email address
Shipp.delivery
Shipp Delivery
Shipp.tk
shipp.tk

Recently Updated Websites

Schoolteachertoday.com (9 seconds ago.)Support-smsmt.com (11 seconds ago.)Drushyakavya.com (14 seconds ago.)Guimeramorella.com (15 seconds ago.)Escapepen.com (15 seconds ago.)Rafconnect.org (15 seconds ago.)Awaqo.com (18 seconds ago.)Brookingsdermatology.com (19 seconds ago.)Maxys.com (19 seconds ago.)Prediksisgp.net (20 seconds ago.)75ug.com (21 seconds ago.)Gruposuport.com.br (22 seconds ago.)Bossvzion.com (24 seconds ago.)Reach19.net (24 seconds ago.)Yourmagicaljourney.com (25 seconds ago.)Justdoit.org (27 seconds ago.)Writeanalog.com (28 seconds ago.)7850yb.com (29 seconds ago.)Spr-kleefeld.de (30 seconds ago.)Romanellicouture.com (30 seconds ago.)Lmx.holiday (32 seconds ago.)Karnatakatraveldiary.com (33 seconds ago.)Opyc.club (33 seconds ago.)Sprylyfemedical.com (35 seconds ago.)Demamdangdut.com (35 seconds ago.)Kerolli.com (37 seconds ago.)Grbinc.com (37 seconds ago.)Jasonlewis.net (40 seconds ago.)Reiscpa.com (41 seconds ago.)Kopvanhetland.nl (43 seconds ago.)

Recently Searched Keywords

https: www.teencoreclub.com media galleries 789 dpp_0[001-500].jpg (5 seconds ago.)alsscan nata shake it (10 seconds ago.)g cng (21 seconds ago.)japanese mom (23 seconds ago.)si sv (24 seconds ago.)services and information (30 seconds ago.)paterson (30 seconds ago.)slide card wallet (38 seconds ago.)tdsocialbutton aafter width (39 seconds ago.)öð¹úóæòµ±£³öî轡ôö³¤ì¬ê棬2019äêððòµ²úöµ¹æ䣳¬2.64íòòú [í¼] (39 seconds ago.)plikw (43 seconds ago.)κώτσης (43 seconds ago.)adam block (43 seconds ago.)cylinder (44 seconds ago.)savingsqqtypeqqenterpriseanimationlinkqqcompoundtypeqqenterpriseanimationlinkqqcontenttypeqqenterpriseanimationlinkqqnameqqenterpriselinkqqdisplaynameqqenterpriselinkqqurlqqbankcdsonline-cdsqqtextqq360 (46 seconds ago.)wallstreet exchange near me (46 seconds ago.)office blog (47 seconds ago.)3850 gateway (47 seconds ago.)gallery two (50 seconds ago.)spanafterbackground-color333333media (50 seconds ago.)bokep jepang (52 seconds ago.)stationery tape (57 seconds ago.)pauseonhover singleslider3pauseonhover (1 minute ago.)zip or postal code of udayapur gadhi (1 minute 16 seconds ago.)сексуальная, горячая и умелая, знаю, что тебе нужно (1 minute 20 seconds ago.)slide card ps2 (1 minute 24 seconds ago.)sahibinden ilan ver (1 minute 25 seconds ago.)resultadosexamenadmision (1 minute 25 seconds ago.)ふりかけ レシピ 煮干し (1 minute 29 seconds ago.)Sattakingresult61blogspot.Com (1 minute 41 seconds ago.)