Shisha-nil.de  |  Shisha Shop - Wasserpfeifen Tabak Zubehör | Shisha Nil
Low trust score  | 
Der Shisha Shop für Wasserpfeifen, Tabak und Zubehör mit einer großen Auswahl an Markenherstellern zu niedrigen Preisen.

Shisha-nil.de Website Information

Shisha-nil.de has a Low Trust Score, a Statvoo Rank of F, an Alexa Rank of 178,977, a Majestic Rank of 0, a Domain Authority of 32% and is not listed in DMOZ.

Shisha-nil.de is hosted by TOT Public Company Limited in United States.
Shisha-nil.de has an IP Address of 104.28.21.42 and a hostname of 104.28.21.42.

The domain shisha-nil.de was registered 201 decades 8 years 9 months ago by , it was last modified 6 years 6 months 2 days ago and currently is set to expire 201 decades 8 years 9 months ago.


Whois information for shisha-nil.de

Full Whois Lookup for Shisha-nil.de Whois Lookup

% Copyright (c) 2010 by DENIC
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%

Domain: shisha-nil.de
Nserver: alice.ns.cloudflare.com
Nserver: west.ns.cloudflare.com
Status: connect
Changed: 2016-01-23T17:37:02+01:00

[Tech-C]
Type: PERSON
Name: Bastian Schneider
Organisation: creen.web
Address: Kolpingstr. 41
PostalCode: 69469
City: Weinheim
CountryCode: DE
Phone: +49 6201 878561
Fax: +49 6201 878562
Email: Login to show email
2015-11-18T19:41:13+01:00

[Zone-C]
Type: PERSON
Name: Bastian Schneider
Organisation: creen.web
Address: Kolpingstr. 41
PostalCode: 69469
City: Weinheim
CountryCode: DE
Phone: +49 6201 878561
Fax: +49 6201 878562
Email: Login to show email
2015-11-18T19:41:13+01:00

Who hosts Shisha-nil.de?

Shisha-nil.de Web Server Information

Hosted IP Address:104.28.21.42
Hosted Hostname:104.28.21.42
Service Provider:TOT Public Company Limited
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:Not Applicable

HTTP Header Analysis for Shisha-nil.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: cloudflare-nginx
Date: Thu, 06 Aug 2015 12:10:28 GMT
Content-Type: text/html; charset=iso-8859-15
Transfer-Encoding: chunked
Connection: keep-alive
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Vary: Accept-Encoding
CF-RAY: 211aa382d3580a8a-LHR
Content-Encoding: gzip


Need to find out who hosts Shisha-nil.de?

Shisha-nil.de Free SEO Report

Website Inpage Analysis for Shisha-nil.de

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Shisha-nil.de

schlauchsethilfe faq shishastartmazayadampfsteinehookahsharkskshilfechaos tobaccomundstckmolassesamy goldaliceshisha tabakkleineargeliniwaha mixzurshisha wasserpfeifenfachhandelfaq shisha grohandelsultan mix7 nights 200gbubbleclassicshisha ersatzglserpowerdeluxe alu mundstck250gkhalilzahlungsbedingungen kontakt jobseltobacco 200gleonkontakt jobs ausbildungzur kategoriekhalil mamoonschlucheinnocigsel nefesdeluxe alunargilem nps7 daystabak 200gal jazeera tabakdevilset amycaesardeluxesultantabakalumolassenpsfaqkpfeezigarettealu mundstckwiderrufsformular agb datenschutzladengeschft fachhandel150gajamykayawiderrufsrecht widerrufsformularladengeschft fachhandel impressummanial ajamylayalinaglasmundstckewiderrufsformular agbheavensental jazeeraboxshishakartuschennargilem ultimatedatenschutzladengeschftelementssaphirekaya shishapanoramamyaagb datenschutz versandmundstckemazaya tabakjobsajamy goldblackkohlestarbuzzverdampferzahlungsbedingungenfaq shishaedelstahldoobaccoaringramm7 nightsadalya50g alegeglasnightsal ajamy goldimpressumhndlerlogin widerrufsrecht widerrufsformularsonderangeboteamy deluxe aluhotal sultanking2wookahpassionhilfe faqal wahashark productsfantasia0al waha mix200grjeffs seven elementsseven3kontakt jobsline matanullginischaosjobs ausbildung hilfehookahsqueezefakhermigstart now4kategoriepower bowlnowal fakherurloscarshndlerlogin widerrufsrechtline mata leonmata leonkategorie shishabrodatordayslampengrmundstck in boxmamoonpipewiderrufsrecht widerrufsformular agblinemixtobaccomaridantabak 50ggoldversand und zahlungsbedingungenmitvapeausbildungnargilemkontakt200g al jazeeranefesalchemist tobaccoproductsamygolden pipesaphire powerjazeera tabakhndlerloginkaahoo100ggr social smokeamy deluxegrohandel50grversandbrohoodagbcocomataginis tobaccoeshisha50gglasmundstckausbildung hilfeshisha grohandelgoldensocial smoke1kgshisha kingjazeeratruemaridan tobaccozahlungsbedingungen kontakt1 kgtrue passionmix alnights 200geditional sultan mixultimatesmokewiderrufsrechtsocialshisha grohandel ladengeschftkswasserpfeifenalchemistgrohandel ladengeschft fachhandeladalya tabakdatenschutz versand1now tobaccoseriesarin tabakjeffs sevenbowljeffsaluslimtonkopfwiderrufsformularneuheitenstart now tobaccoseven elementsausbildung hilfe faqfachhandel impressumgr socialliquidhazewahakismetzubehrersatzglsersaphire power bowldiamondglas200gjobs ausbildungzur kategorie shisha100mlhassokg200g alal manigrohandel ladengeschftmix 100mldschinniagb datenschutz

Longtail Keyword Density for Shisha-nil.de

KeywordsOccurences
zur kategorie shisha7
amy deluxe alu5
grohandel ladengeschft fachhandel4
shisha grohandel ladengeschft4
widerrufsrecht widerrufsformular agb4
al ajamy gold4
al jazeera tabak4
start now tobacco4
faq shisha grohandel4
hilfe faq shisha4
versand und zahlungsbedingungen4
widerrufsformular agb datenschutz4
al sultan mix4
saphire power bowl3
line mata leon3
al waha mix3
deluxe alu mundstck3
mundstck in box3
gr social smoke3
hndler-login widerrufsrecht widerrufsformular3
kontakt jobs ausbildung3
zahlungsbedingungen kontakt jobs3
agb datenschutz versand3
jobs ausbildung hilfe3
ausbildung hilfe faq3
200g al jazeera3
7 nights 200g3
ladengeschft fachhandel impressum3
jeffs seven elements3
zur kategorie21
amy deluxe14
mata leon11
start now9
al fakher8
al waha8
kategorie shisha7
tabak 200g7
al mani6
amy gold6
7 days5
7 nights5
deluxe alu5
tobacco 200g5
1 kg5
social smoke5
el nefes5
shisha ersatzglser5
al jazeera5
200g al4
mix al4
shisha king4
jazeera tabak4
nargilem nps4
now tobacco4
widerrufsformular agb4
widerrufsrecht widerrufsformular4
mazaya tabak4
faq shisha4
zahlungsbedingungen kontakt4
golden pipe4
ajamy gold4
tabak 50g4
agb datenschutz4
adalya tabak4
hilfe faq4
jobs ausbildung4
ladengeschft fachhandel4
al ajamy4
al sultan4
sultan mix4
grohandel ladengeschft4
shisha grohandel4
shark products3
khalil mamoon3
alu mundstck3
waha mix3
mix 100ml3
set amy3
saphire power3
power bowl3
line mata3
jeffs seven3
alchemist tobacco3
kontakt jobs3
50g al3
arin tabak3
nights 200g3
fachhandel impressum3
ausbildung hilfe3
shisha tabak3
hndler-login widerrufsrecht3
chaos tobacco3
gr social3
datenschutz versand3
true passion3
nargilem ultimate3
maridan tobacco3
ginis tobacco3
seven elements3
kaya shisha3
shisha wasserpfeifen3
tobacco61
shisha52
al41
amy40
tabak36
200g33
zur21
kategorie21
kaya15
deluxe14
mix13
caesar13
dschinni13
mundstcke13
gold12
smoke12
50g12
ersatzglser12
set12
mata11
glasmundstcke11
url11
leon11
hookah11
1kg10
nargilem10
010
bowl9
brodator9
now9
start9
ks8
fakher8
liquid8
line8
waha8
kpfe8
sks8
saphire7
ice7
molasse7
devil6
king6
golden6
starbuzz6
e-shisha6
mani6
edition6
el6
16
kartuschen5
true5
layalina5
nefes5
social5
alu5
sultan5
mya5
kohle5
mundstck5
zubehr5
ultimate5
gr5
jazeera5
chaos5
kg5
adalya5
days5
nights5
gramm5
black5
ladengeschft4
fachhandel4
grohandel4
faq4
100ml4
impressum4
box4
haze4
mig4
nps4
hasso4
wookah4
hilfe4
coco4
verdampfer4
e-zigarette4
agb4
widerrufsformular4
widerrufsrecht4
datenschutz4
versand4
brohood4
ausbildung4
jobs4
kontakt4
zahlungsbedingungen4
molasses4
pipe4
classic4
fantasia4
ginis4
ajamy4
elements4
mazaya4
heavensent4
200gr4
seven3
oscars3
aluslim3
power3
hot3
tonkopf3
series3
doobacco3
shark3
maridan3
vape3
150g3
null3
hndler-login3
23
innocigs3
passion3
mit3
products3
lampen3
kleine3
glasmundstck3
50gr3
panorama3
egeglas3
alchemist3
glas3
diamond3
250g3
100g3
khalil3
mamoon3
argelini3
arin3
kismet3
schluche3
hookahsqueeze3
dampfsteine3
kaahoo3
edelstahl3
33
schlauch3
43
neuheiten3
sonderangebote3
jeffs3
bubble3
wasserpfeifen3

What are the nameservers for shisha-nil.de?

Shisha-nil.de Domain Nameserver Information

HostIP AddressCountry
alice.ns.cloudflare.com 173.245.58.60United States United States
west.ns.cloudflare.com 173.245.59.247United States United States

Shisha-nil.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Shisha-nil.de is a scam?