Shk-journal.de Website Information

Shk-journal.de has a Low Trust Score, a Statvoo Rank of H, an Alexa Rank of 641,879, a Majestic Rank of 0, a Domain Authority of 32% and is not listed in DMOZ.

Shk-journal.de is hosted by 1&1 Internet AG in Nordrhein-westfalen, Hennen, Germany, 58239.
Shk-journal.de has an IP Address of 213.165.69.163 and a hostname of shk.shk-journal.de.

The domain shk-journal.de was registered 201 decades 8 years 11 months ago by , it was last modified 6 years 9 months 4 days ago and currently is set to expire 201 decades 8 years 11 months ago.


Whois information for shk-journal.de

Full Whois Lookup for Shk-journal.de Whois Lookup

% Copyright (c) 2010 by DENIC
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%

Domain: shk-journal.de
Nserver: ns37.1und1.de
Nserver: ns38.1und1.de
Status: connect
Changed: 2012-08-22T13:52:46+02:00

[Tech-C]
Type: ROLE
Name: Hostmaster EINSUNDEINS
Organisation: 1&1 Internet AG
Address: Brauerstr. 48
PostalCode: 76135
City: Karlsruhe
CountryCode: DE
Phone: +49.7219600
Fax: +49.72191374248
Email: Login to show email
2012-12-10T20:50:22+01:00

[Zone-C]
Type: ROLE
Name: Hostmaster EINSUNDEINS
Organisation: 1&1 Internet AG
Address: Brauerstr. 48
PostalCode: 76135
City: Karlsruhe
CountryCode: DE
Phone: +49.7219600
Fax: +49.72191374248
Email: Login to show email
2012-12-10T20:50:22+01:00

Who hosts Shk-journal.de?

Shk-journal.de Web Server Information

Hosted IP Address:213.165.69.163
Hosted Hostname:shk.shk-journal.de
Service Provider:1&1 Internet AG
Hosted Country:GermanyDE
Location Latitude:51.4425
Location Longitude:7.65129
Webserver Software:Not Applicable

HTTP Header Analysis for Shk-journal.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 12 Sep 2015 07:44:01 GMT
Server: Apache
X-Powered-By: PHP/5.5.28
Transfer-Encoding: chunked
Content-Type: text/html; charset=utf-8


Need to find out who hosts Shk-journal.de?

Shk-journal.de Free SEO Report

Website Inpage Analysis for Shk-journal.de

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Shk-journal.de

wollen wachsenzusammenarbeit mitber 110 jahrenseit jahrzehntenmit der muttergesellschaftrichterfrenzelsucht frviega8erhltlichmw in bremengroraum frankfurtmw gebudesystemtechnik referenznrlohnfertigunglx jubilumsset 1von armatureninnovative produktekonzept zurvonnbsp haustechnikpersonalproduktemitarbeiterin imlsungarea salesverkufer angedachten zeitder vorreiterdie mittelstandssolidittnachfolgeregelungen in derrauchmeldermontagen in mnchenmengen vonklimatechnik bei10die neuebiswilhelmfr ihre vakanzensucht area saleshargassner isturbanmagische anzahl vongesucht wirfinden siehaustechnikpersonal soumfasst die verantwortlichekofen gehrtmit der marketechnischewimtec ocean e10mehr sie verlassenunser mandant mitteamleitergmbh fachhelfer frintelligentsie bitte mehrfhrender herstellerviega suchtneuulm aktuelle trendsenergie und weiterfachhandwerkcamina speichersteinanlagemw regionerhht damitber 60 jahrenmitte zurzeitbadewannen oder waschtischegesundheitsgefhrdendekuhfussgmbh gehrt1 umfangreiche betriebsanalysedeutschersicherheit und solidittunserenformat ihren lieblingsvereinproduziert und vertreibtbrunata sucht kundendienstmonteurwindhager suchtvon weiterunsereangebotweiter 24072017starkerzusammenarbeit37das neue trikothaustechnikder muttergesellschaftbrauchtleider scheitern vieleeiner der fhrendenkundendienstmonteur mw zurglobaleshktvmit hchstemprojekteherz wartetradon dichtungseinstze von3302 lx jubilumssetsanitr agheizen mitraumbetreuung innerhalbfr peinemanndem zufallgebiet derfr den groraumeinmal drngtbrunata suchtgasetechnikkunden voninnendienstinnovativegebietsleiter mwknnen sich beidicht nachlftungssysteme mit wrmerckgewinnungbadenwrttemberg mittewest homeofficepersonalberatungfhrten zurvertreibtsuchtauendienstmitarbeiterprofitieren von diesemzur nachfolgeregelung 1sie sichweiter 31082017mw nordrheinwestfalenwachsenauendienst mw frhaustechnik sucht04052017sofort direct searchroyalzum themaprsentiert zahlreicheeiner weiterberlasse nichtskunden von haustechnikpersonalden praxisfortschrittschnellehh heizungssymposium zumkleinschmidtdeinzer und weylanddie magischeder weltweit fhrendender muttergesellschaft fraeg zukurz mahbewegen strom1werden auchmitarbeiter sind24hmessgerteservice fr abgasmessgertevertriebsmitarbeiter imeindie verantwortlichelftung fr dieschickt uns bekanntlichhomeoffice design przisionaussendienst fr dasmandant alscommotherm luft wasserdelabiewaterals weltweit erfolgreicherals 110 jahrenfachplaner tga dieder regionallianzein sterreichischeraquis sanitrxamdie caminazu dieserwattssanitr heizungsangedachtenso sind sieberlinsucht vertriebsmitarbeiterinbrunata mnchen istdetailinfos zuess duschrinne neusteht frmah istvon vielennbsppersonentage in daswasserproduktmanager wm trinkwassersystemepelletskessel mitdie regionschlick und wolfklicken sie bitteltw mnchender rauchmeldermontagenhackgutim bereich luftnicht das einzigeprojektleiterhydraulischerrheinlandsd zurzeit untersttzenindustriehandelsvertretungverkaufsregionmandanten einklima dieconti sanitrarmaturenlftungallianz haustechnik kurzim messgerteservice fhrtenservicekonzeptesvertriebsprofi heizungstechnikmw aus1989 zwei strategiendas sauerlandpowermesseintensive betreuung innerhalbweiter 06072017vernetzten mobilen heizzentralenrotexlftungstechnikregionmaschinenbau73ab werkweiter 24042017innovativvertreibt innovative lftungssystemevertriebsprofi heizungstechnikmwhaustechnikpersonal profitieren von60 jahrenhomeoffice vielprofis frmehrwerten vonnbspabgasanalysegert testoltw mnchen kgsind wirhackgut pelletsmagischegebudeuponor gmbh produktmanagerjeweiligen unternehmens verbundenbad direkt weiterdamitdasdirekt weiterthemader kundenberatung sowieverbindet viega diespiegelschrankunternehmen wir sindneu1071 groraumservice techniker norddeutschlanddie deinzerheizungleistetsonnenkraftbrtje gmbh istsystemtechnikhaustechnikdwmbfreistehendekomplettset badbereichkofen sucht einenbietenquelleweiter 06092017peinemann sohn projektleitergmbh suchtenergiewendeeffektiveranlagenmechanikermeisterin oderengineering istfr hydronischesucht technischenw schneider hatfrankfurt familienunternehmenerfolgschancen preisgnstigsuchen wirdie hygienischestarker partner vonaco haustechnik rckstausystemeprodukttechniker mwdas den ortsobauendienst fr daswasser wrmepumpe01082017dmpfe sowiefachgrohandel frviega seit mehrmitarbeiterin im innendienstwerdeneinem der spannendsteninternationaler hersteller derbereit frbitte mehrklimaluftung mwsie ihre weiterstandort attendornzuverlssigefr kesselheld gmbhmotivationsie ihrewolf istgrohandelskaufmannein unternehmenfr hannover10000 kontakten beiwimtec oceanweil er vielebauen den kundenstammziel mehrpellets und stckholzheizungenluftschneider hat ihreshk standortdurch dasanzahl von 10000netzwerk xingsie bauenhaustechnikpersonal bisflexibeluhrimmerteam vonfr germann gmbh17wollen wachsen sieschutzpunkten mit weiterhamburg aktuellreferenznummerauf demkundendiensttechniker mw frer viele weiterist judo derstandort wormsdirektinteressewmeinem gehaltnutzeneuropa zugrohandelskaufmann mw sanitrsie innovationsfhrereinem weitereffektiver schutz gegenunser bewhrtes5frling suchtbesonderenhersteller imvertriebsmitarbeiterinist eine einkaufsgehren wirverffentlicht die logosniederrhein homeofficedie augustallianz haustechnikwieder einmaleinen fhrendenattendorn seitwrmerckgewinnungkesselheld gmbhjahren istdirektehaben mchtender lohnfertigungkesselaquathermgermannnach norm dinspannendstenwasser wlderden neuen standortfr mobilerltanlagenbau klimaluftungwerkzeugiwoschicktmandantenco kgzwei strategien einbund18panasonicvideoprsentationfhrenden anbietersauerstoffmangel aufdicht mit 10fhrenden europischen herstellereinkaufsber 700 mitarbeiternradonwrmepumpe abverantwortliche durchfhrung68markesanitrbranchemw hargassnerdie perfektestellt218 3092017den zweigniederlassungen ghoffmannab sofortvertriebsprofibder aus einheitlicherjahre erfahrungenherstellern derbad weiterwir mitbietet stelle alsviega die sicherheitfamilienunternehmenmandant steht alsfr die nachfolgeregelungkesselheldeuropaalledas einzigedie august brtjeweylandrckstausysteme schtzen vorjetzt auchklicken sind siezweigniederlassungen ghoffmann urbanals shkprojektleiterfr alle diegarantiedesmit universal prfbonusproduziertkln aachen niederrhein01092017mnchen brunata mnchenwebinarbesuchenden fhrenden3092017 untersttzenbei viega seitmit dermuttergesellschaft frnordhessengroraum stuttgart referenznrunternehmen unser bewhrtessind nichtsanitrbranche suchtwimtecumsatzsachbearbeiterder heizungsdem gebietwir punkten mitvarber 80 jahrenflexzarge schnittschutzaufgabenstellung umfasstmw projekte frfachplanerbadbereich dicht mitsucht grohandelskaufmann mwangebotsaktion drgerzu denaccountjudo der vorreiterweiter 31072017klimatechnikknowhow zahlreiche innovationengabag flexzarge schnittschutzsorgtmit einereiner der weltweitdie unternehmensberatung ewalddienstagmuttergesellschaftdurch intensive betreuungbekanntlichuponor ist einer24hmessgerteserviceverlassen weitermit unswrmepumpenden gesamtservice frfr hydronische weiterder ratiopharm arenaprojektleiter rltanlagenbauob duschflchenverstrkung kundendiensttechniker mwheizungssymposiumherz attackeder shkbranche suchtsucht fachberaterbietet stellefr innovativehydronischedeinzerder fhrenden herstellerwir wollen24schtzen voruniversalmw mittereferenznummer 062017 imiallianz haustechnik suchtprzision09082017wir einen fhrendentechnischendesignsitzsucht geschftsfhrerdurch eine weiter69modernendas neueanzahl vonreferenznr 1077 nrwschrittmit der karriereseiteschnittschutztechnikerals bewerberihrentrikot der saisonkundendiensttechnikerkermikundenmnchenfr uponor gmbhrepabadsucht fr thermondogrndung vor bertrinkwassersystemeohnegebietsleiter mw projektehomeoffice energieeffizienz wirtschaftlichkeitder sucheder karriereseite desauf kannweltweit fhrenden anbietermehrwerten vonnbsp haustechnikpersonalkann esdie wimteczu dieser meldungschweinfurtshkbetriebe mitist ein unternehmentrinkwassersysteme standortebei der weiterfr die region6505072017den fhrenden herstellernbemmsucht planerberater wrmeverteilungder weltweitteamleiter mwpersonal sucht33hydronic engineeringenergiewende die sonneim auendienst frshkbetriebezu bieten hat46handwerkerhaustechnik sucht grohandelskaufmannauftraggeberglobal watervereinthaustechnikpersonal so sindoder frankfurt uponorhandwerkeraktionwerk weitersie mit formatdezember 2017sonne schickt unsgegrndetekommtfamilir und innovativfhrendeseuropaweit zudie sonne schicktdem raumverstehen es unsere700 mitarbeiternmit kaldewei werdendirekt ab werkdie region bremennatur sindaquis sanitr agkhlenzuverbundenkeymw wassersowie sauerstoffmangelkennenfunktionalittnach normfachplaner tgahaustechnikpersonalwasser sparenfr den neuenangebot frnetzwerkvor ber 80unternehmen wenn sieder ratiopharmumweltschutzve 200aus dem raumplanerberater mwdrgertrinkwassersysteme standorte hafurtwrmepumpevakanzenstuttgart homeofficedas verkaufsgebietunberhrteweyland suchtunser auftraggeber istseit 1989gebietsleiter auendienstmitarbeiter mwocean p11sucht grohandelskaufmanndarauf klicken sinddrger xammw fr diehaustechnik aufzum thema energiewendeweiter 15092017der mrkte mitihremdie aufgabenstellung sieattackefr die weitervakanzen zu findenbeisucht fr peinemannmanager mwdetailinfos zu diesersanibadfachgrohandel fr gebudetechnikweiter 23052017groe mengensterreichischereinfachmandanten bei dernicht nurzahlreicheconti sanitrarmaturen gmbh05092017luft wasserklimazielewaschtischeder suche weiterhppe gmbh gehrtverstehensanitrarmaturen gmbh2017 weiter 08092017weiter 11082017als fhrenderunternehmen der shkbranchegebudetechnik referenznrfr gebudetechnik derw schneider unternehmensnachfolgemontagespezialist vongersthofen technischesweiter 30082017wurdeinnerhalb ihresviega dietesto 3302unternehmens1301 unserinnovatiververstrkungden gesamtservicekarriereseitefr das gebietherz commotherm luftlieblingsvereinfestermahgrohandelskaufmann mwschutz gegenbereich der haustechnikdarauf klickenuntersttzen wirdrger bieteteinem derkomfortmrktezu den fhrendentrends beimandanten beiqualittskontrolle derdas sind wirmit nutzen siehierwassertechnikein fester begriffhufig treten gesundheitsgefhrdendesauerstoffmangelanbieter vonpersonal sucht juniorwirtschaftlichkeitein fachgrohandel frgersthofen technisches knowhowweiter 18052017lxanbieterattacke innovativeab sofort werdenmit dembaueninternationalim bereichsanitrtechnik istcontijahren wir verstehenmengenfirmanach einemduschflchen badewannen oderdie aufgabenstellung umfasstwir wollen wachsenerstmaliggmbh angebotsaktionattacke innovative produktediedas team vonareatechniker norddeutschlandihrernetzwerk xing berschrittenfamilienunternehmens mit weiterber 60uponor gmbhzurihre dienstleistungbettehaustechniknachfolgeholen siedeinzer weyland gmbhpluggit suchtpunktenltwerfahrungen imalsbei derpersonalberatung seit 1989wir mit deraco haustechnikelektronischeeiner ganzdrger bietet hierthringenleiderviega sucht produktmanagernordrheinwestfalen sd zurzeitmit einer premiumvorstellung 24hmessgerteservice frdie sicherheitaachen niederrhein homeofficeaquiswhlersetzenweiter 04082017projekte frxingkundendienstmonteur mwenormen kontaktpotential mitdu an einemreferenznr 1071 groraumworms die deinzermw alssowie als shkprojektleiterweilsucht kundendienstmonteur mwfr peinemann sohntechnikerinsucht vertriebsprofiheizungstechnikmwganz besonderensucht einenpureswasseraufbereitung weiterweiter 09082017gabagein zielmitarbeiterinnenihre vakanzen zuneuulm aktuelleglobalsie bitteperfektegebietsverkaufsleitergrohandeltestosucht vertriebsmitarbeiterganznichts demauf werden auchmw groraum stuttgartsystemen fr diesauerland zumit dem weiterbadewannen oderansprchestrategien einberschritten kundenfr innovative fachhandwerkerfr gebudetechnikkeine rechnungweiter 08082017sucht gebietsleiter sanitrein eigentmergefhrtes80 jahren53interessanter5990 herzdensucht vertriebsmitarbeiter imkesselheld gmbh fachhelferhat ihrevielennbsp mehrwerten vonnbspriho suchtoder frankfurtneue formatfhrender hersteller vonkontaktendie motivation unserersteuerungstckholzheizungenzu finden abdie zeithosanit1 umfangreichesucht verkaufsberater mwdie gabagweiter 07062017aussendienstzur miete dieews 1301thermondo23diesemniederschlag auf kannsdoder technikerin shkoventrop sucht vertriebsmitarbeiterinnovativenafrisoinsdem unternehmen bewerbenmw fr dassindhandelhandwerkklimatechnik bei dervom verkuferarenawachsen sie auchsoliditt eines familienunternehmens16mieteab werk weiterfunktionalitt unserzukunftocean e10fachhelferflexzargeeffektiver schutzeuropischen herstellerw schneider personalberatungnatur sind nichtwolf ist weiterpremium weiterhchstemsohn projektleiter rltanlagenbau3302ist einebereittrinkwasserhygieneauf drger bietetsaarlandeinzige was dasduschrinnebewerben dasjahren garantie weiterihnenam standortfinden ab sofortweiter 29062017nichts dem zufallniederschlagbewerber frumfasstvom 18 3092017videokundenstammgermann gmbhverkaufsberatersoder fhrende spezialistwrmeverteilung und lftungberatungdas sindunseren mandantenromayweiter 26052017gebietsleiter45biomasseheizungenkleinschmidt gmbh vorstellungfr kesselheldreferenznr 1080herz wartet wiederamsucht planerberatervon 10000dmpfeduschflchen badewannenoceansohn projektleiterangebotsaktion 60die verkaufsregionhygienische weiterleipzigein festerhydronische weiterwollenfachhandwerker herz commothermproduktmanager mwniederrhein homeoffice energieeffizienzmw imbereich lufthaben unsweiter 04052017gemeinsam mit31unseresbei viegasonnefr die hygienischesucht fr kesselheldwichtigeden standortgmbh mitweiter 22082017sind nicht dasmussmit ber 100einenweiter 28072017jahren wirweiter 05072017gmbh vorstellung 24hmessgerteservicelsungenhydraulischer abgleichfhrenden unternehmen wirdie aufgabenstellungnorddeutschland mw referenznummerseit mehrder international aufgestelltenseit derhersteller der heizungsgeberitschtzenist einer derabgasmessgerteweiter 10082017viel bewegen strommitte zurzeit untersttzen10 jahren garantieheizung klima diemittewestpraxisfortschritt der mrkteoderkaldewei suchtbewerben das istmittewest homeoffice alsweiter 30082017 neueenormenaachen niederrheinunternehmensnachfolge leiderfr einenergyvon haustechnikpersonal profitierenfhrende globalekommendurchratiopharmnorddeutschland mw9zumnrnbergmnchen brunatamitarbeiterinnen habensucht geschftsfhrer installationspersonal sucht gebietsleitersparen unserder internationalsind wir beieffizienteseit 1989 zweihomeoffice viel bewegendaraufservicebvweiter 01092017universal prfbonusprodukte frsie als bewerberoventrop suchtmit weitergroe mengen voneigentmergefhrtes mittelstndisches unternehmenherz commothermmw projektebadenwrttemberg sdostgermann gmbh anlagenmechanikermeisterinneue trikotvertriebangedachten zeitauch sie innovationsfhrerlangeherstellern innovativerseit der grndungnach einem weiterauftraggeber ist dererhht damit weitermobile wrmespeziellneuenordrheinwestfalenmitarbeiterinwirtschaftinnerhalb einesfhrendelsungen fr dieder fhrenden europischendie speichersteinanlageabunser mandant alsgebudetechnik der alsrckstausysteme schtzenberzeugtnichtneueruntersttzenweiter 20062017als internationalerregion stuttgartzur nachfolgeregelungmit berbereichmoderneindustriesein fhrendes unternehmenvasco suchtvor ber 60engineering sucht servicehamburg aktuell untersttzenstrategienlsungen freuropaweitherbst 2017mandant istweiter 30062017scheiternengineering suchtqiotga diegestalten denprojekten mit demattraktivendirekte und weitersie sich daswachsen siedas ist einermw sanitr heizungbad18534 komplettsetdeutschland planungneu alles dichtvertriebsmitarbeiter mwihrebeimbetriebsanalysewenn sie weiterefhrenden herstelleroventrop istfachhelfer fr heizungsinstallationnach dindesign przision qualittseites durchvielenschnittschutz istkey accountsucht kundendiensttechniker mwjedenkg suchtfr die verkaufsregionentwicklung eines neuenetablierteverkaufsberater mwgebudesystemtechnik referenznrdeinzer weylandregion kln aachen25kundenberatungghoffmann urban56pluggit entwickelt produzierthat hiervon diesemunser mandantmacht18 3092017 untersttzenpremiummchtenklnstiebel eltronluft wasser wrmepumpeaktioninternationaler herstellerunser mandant stehthaben uns weiterden kundenstammservicekonzeptes weitertrends bei dasgmbh gehrt europaweitherstellerbekanntlich keine rechnungheiztechnik fr deutschland51entwickelt produziertden orts weitervor berdigital vernetztendem unternehmenvorstellungmittelstandsauf werdenber 700knowhow zahlreichesystemtechnikhaustechnik sucht planerberaterww personal suchtvonnbsp haustechnikpersonal soewald wunternehmen bewerben dashsk prsentiertbrunata mnchendetailinfosbetreuung unsererleider scheiternheiztechnik suchtsterreichischer herstellerservicetechniker mwder vom verkuferoktober 2017 1700wzu einerherbstcommotherm luftuns arbeitest duweiter 02082017bereich systemtechnikhaustechnik1080 badenwrttembergzeit weil erfrling ist15orts weitervascokundenstamm durchfr einegestaltenneuen standortlohnfertigung ews 1301maschinenbau imseptemberder grndungklimaumessfr heizungsinstallationbei dasdes jeweiligen unternehmenssterreich24hmessgerteservice frfrankfurt familienunternehmen mitdassmobile heizzentralendie hppe gmbhsofort direct5990 herz wartetanlagenmechanikerbis zugeschftsfhrerwasseraufbereitungshk standort brensbachanbieter von systemensystemen und lsungentechnischen auendienstsuchedie mittelstands allianzdie hppedmpfe sowie sauerstoffmangellogosmit sonnenkraftneuenwennes66platzhersteller vonbedienkomfortduschenhaben7408082017hersteller von armaturenmittelstands allianzgebietsleiter sanitrist ein sterreichischererstes ehh heizungssymposiumist daskundenberatung sowie alssucht projektberater mwzur entwicklung einesbei dem beruflichenverkaufsberater mw groraumwebinar danfosssie verlassen weitersind sie alsim groraum frankfurtfhrendes unternehmenqualittskontrolle der rauchmeldermontagenhandwerkeraktion vom 18sofort werden durchallesmehr siesie auchentwickeltbewerbenwrmeverteilungberzeugt mitcoaus weiterflexzarge schnittschutz istfhrendes unternehmen dernatur2017 1700 uhrsucht mitarbeiterumfangreiche betriebsanalyseliegtuns bekanntlich keineaus einheitlichertechnologiefhrendergrteaufgestellten bdr thermeagruppewartung49shkbranche bei derjahren verbindet viegasinusverteilertreten innerhalbhaustechnik gehren wirgegenwir unseren mandantenklima die mittelstandsspeichersteinanlagewir beides jeweiligenfindengebietgebietsleiter mw gebudetechnikdicht nach normnorddeutschlandsaison weitergroeder wasseraufbereitunghafurtgase und dmpfepunktesystemqualitt60fr unseren57sondernsolutionsfr die haustechnikden kundenstamm durchfester begriffnachfolgeregelung in dertrikotwasser sparen unsergmbh produktmanager wmkomplettensich39sowiemitarbeitern weiterkeine rechnung weitertechnikerin shkkundendiensttechniker mwstuttgartderampintensive betreuunginnovationenabdichtungaugust brtje gmbh41eltronunternehmensberatung70repabad suchtbesuchen sie sonnenkraftmachenspezialistfr hannover aktuelldallmerweiter 280620171077 nrw region10000 kontaktenklimatechnik sucht areasind sie direktkundendienstmonteurzur qualittskontrolle derneuheiten in neuulmgehalt dasmittelstndisches unternehmen mitsucht vertriebsprofi heizungstechnikmwmobilenbietet den gesamtservicemit kaldeweimw gebudetechnik referenznrunternehmenwerkden bereichbadplanungrundheiztechnik frsanitr mw40markenserviceoventropludwigsfelde dieaktuelleines kurzenmw im auendienstriho sucht frdoymadem weitere10normbayernmit dem m3bbadplanerweiter 13092017duschflchenkomplettsetwir unserensauerland zu bieteninstallations und heiztechnikservice technikerprofitierenviega sucht produkttechniker7jederzwei strategienzielgruppen architektengeschftsfhrer maschinenbau imdurchfhrungweiter 14082017kuhfuss delabieenergieeffizienzvielennbspmw wasser wldernrwvon 10000 kontaktenmandantals weiteraktion aufunser auftraggeberweiter 05092017gestalten den praxisfortschrittweiter 13062017bewerber darauf klickenkofen suchtfrderungviele weiterengineeringbei demvon industriewindhager sucht vertriebsprofieinmaleines neueneuropaweit zu denschell suchthausfhrenden hersteller vonsauerstoffmangel auf drger63plzsucht fr uponorsanitrarmaturenzu findenprofis fr profislx jubilumssetmw sanitrweiter 08092017heizungstechnikmw ausmarkenservice direktagsonne schicktdinnurbekanntlich keinestandorte hafurt oderteamseit mehr alslohnfertigung ewsist der fhrendefhrendes unternehmen imdamit weiterweiter 21082017vasco sucht planerberaterhochwasserschden treten innerhalbdas weiterder mrkte12hannoverbrtjeweltweit erfolgreicher weiterzweigniederlassungenwhler ve 200aachenden neuenweiter 24082017hersteller im bereichdwmb suchtnicht dasleistet abuntersttzen wir einenbuildingzurzeitgesuchtindustries europe bvgemeinsamsanitr heizungshkprojektleiter mitjeweiligen unternehmensmotivation unsererschtzen vor hochwasserschdensie verlassen07062017frlingwannenmah mittelstandsfrling ist einerder alsjudo sucht fachberater0720176trendsgmbh ist einplanensdost zurzeithaustechnik gehreneiner vonvertreibt innovativenrw regionmit format ihrenmit wrmerckgewinnung frgehtkonzept zur nachfolgeregelungjahren garantiehomeofficekurzen zeitraumes groejahren verbindet0809201759weil erwwclagearmaturensind ein weiterwirdim angebotmiete dieinnovativ dasreferenznr 1077stelle alseuropischen hersteller innovativerdas sauerland zum3bbadplanergutihre monteurewaschtische mit kaldeweiseit ber 110offenburgweiter 07092017bereitsgebudesystemtechnik referenznr 1077mw frbewegendas baddirekt mitstandorteeurope bvdie sonnedirectheizungs klimaoder technikerinunternehmensberatung ewaldgarantie weiterewald w schneiderweltweitdie unternehmensberatungvorreiterdesign przisionkampagnebrensbachbegriff das vorsucht service technikerverkaufsgebietfr germannnachfolgeregelung 1gebudesystemtechniknord67meldung haben mchteninternationaler06072017wannen exklusive handwerkeraktionpassende bewerber frabgasanalysegert testo 3302mw rohrleitungssystemegmbherweitertkey account manager26europa zu denheizungssymposium zum themagegrndete weiterschnellemitmittelstands allianz haustechnik75der kundenberatungweyland bietetpraxisfortschrittreferenznr 107119aberbei weiter22schneider hat erstmaligprodukttechnikerenergiewende dieneuheitensie mitpeinemannbei interessegebudetechnik dermitarbeiterfr hamburg aktuellerlogos interessanterumsetzung derdrngt die zeitsie direkt mitder vorreiter aufim groraumkarlsruheunternehmen mit berist diedeutschewrmepumpe ab 5990stckholzheizungen imgeschftsfhrer installationsfr heizungsinstallation regionzur entwicklungfhrender hersteller immehr alsweiter 09062017attendorn seit berghoffmann urban schlicksuche nach einemeinen fhrenden herstellerbadenwrttembergab 5990 herzsowie sauerstoffmangel aufaccount managerum dieweiter 20042017sucht areajahre testomw zur qualittskontrollehufig treten28im badwird diebitte mehr sieerfahrungen im messgerteservicerckstausystemeuntersttzen wir unserenunternehmen bewerbenthemen imsparenerstmalig die magischepersonalberatung seitrohrleitungssysteme metallschneider unternehmensnachfolge leiderbetreuung innerhalb ihresihre weiterintensiveals weltweitpersonalmchten klicken06092017flssigkeitskonditionierung in heizungsverbindet viegaschickt unssohninternationalevon systemenschneider3dgehrtpartnerpraxisfortschritt dereine weiterwenn sieinnerhalbmotivation unserer mitarbeiterinneneinmal mitenergiebewerber daraufsich das neueherz attacke innovativeconelaus einheitlicher weiterhersteller derweiter 27042017duschrinne neu allesdynamicheizungsinstallationmittewest homeofficeknowhowplanerberater mw zurzeitmw hargassner isterfolgschancenbundesweit07092017die magische anzahlzu 3 personentagemah ist einekofenschonaufgestellten bdres durch eineprojektgeschftspeziell frberschritten kunden vonunser bewhrtes konzepthygienischeunternehmens verbundenhandwerkeraktion vommrkte mitber 100werden bder ausfr abgasmessgerteeinheitlicher weiterinternational aufgestelltenknnen sichprojektberatersucht produkttechniker mweiner ganz besonderenwlder und unberhrtefhrtenbad direktunternehmen im bereichdurch das teamshkbetriebe mit digitalwindhager1301 unser mandanthargassner suchter vieleder vomjudovor hochwasserschden tretens4sucht juniorbdr thermeagruppe mitbietet derfr allemehrwertensie direktaktuelle trendsschneider unternehmensnachfolgeder sanitrindustrieweitere detailinfoskundenstamm durch intensivemah mittelstands allianzeinheitlichersie innovationsfhrer weiter60 weiterjunior verkaufsberaterehh heizungssymposiumweiter 04092017anlagenmechanikermeisterin oder technikerinein fachgrohandelinnovative produkte frangebotsaktion 60 jahregebudetechnik referenznr 1080auendienst frbrtje suchtjubilumsset 1nordhessen technischesschimmelbildungfhrenden anbieter vonder shkbranchemnchen kgalles dicht nachist ein eigentmergefhrtessucht servicetechniker biomasseheizungensimplexglobale anbieter38gegen radonaufflachhaustechnikpersonal sucht frauendienstmitarbeiter mwklimatechnik sucht auendienstmitarbeitergebietsleiter mw gebudesystemtechnikhydronicihrem unternehmenhargassner ist einarchitekten und fachplanerbietetder fhrendenhersteller von hackgutrltanlagenbau klimaluftung mwfortechweiter 28042017judo dertreten gesundheitsgefhrdendelftungssystemesystemtechnikhaustechnik suchtdirekt abaushafurt oder frankfurtunsere produktegebiet der wasseraufbereitungwerden durch dasviega seitfrvon haustechnikpersonal bisfachhandwerkerschornsteintechnikbadenwrttemberg mittewestsuche weitereines kurzen zeitraumesfhrungsaufgabenweiter 26042017bewhrtes konzept zurbremen die aufgabenstellungexklusive handwerkeraktionumsetzungdiesem enormen kontaktpotentialweiter 19072017kleinschmidt gmbhstellebei dem unternehmenkundenberatung sowiehaustechnikpersonal bis zugesamtkonzeptgmbh angebotsaktion drgerber dasunberhrte natur sindaktuell untersttzenacoeines familienunternehmensformat ihrenfr ihre monteuredamit weiter dietga die aufgabenstellungscheitern viele nachfolgeregelungenhaustechniknachfolge bietetsucht gebietsverkaufsleiter mwnachwir verstehen esprofitieren vonfrankfurt ein fester07082017dieser meldung habenprojekteneffizienz04082017logos interessanter unternehmendanfossprsentiert zahlreiche neuheitenschnittschutz ist diewir sindeinfachemw fachbereichmit 10 jahrenjahrenawardhat hier weiterbeliebteproherstellern der sanitrindustrievertriebsleiterinteressanter unternehmender als starkerder fhrende globalewir einenvon projekten mitshkhandwerkals shkprojektleiter mitdreiunternehmensberatung ewald wmobilen heizzentralensystemtechnikhaustechnik bei derkontaktpotentialeines derwolfmit uns arbeitestziel mehr weiterwieder einmal mitweiter 03082017wdvmollinumsetzung der entwicklungsstrategiedeutschlandbdrregensburgelectricdie nachfolgeregelungsanitrindustriejahren gegrndete weiterwindhager sucht verstrkungbetriebhydronic engineering ist062017 imi hydronic55planunggerterotex suchtder haustechnik gehreneinkaufs und marketingverbundgruppedichtungseinstze vonplanerfamilirals bewerber weiterprojektberater mwvon niederschlagbegriff dasweyland gmbhgabag flexzargebewerber weiterengineering ist derhargassner sucht servicetechnikerhat ihre dienstleistungmessgerteservice fhrten27shkbranche suchtschneider personalberatung seitbadbereich dichtjahren gegrndete42uns bekanntlichpersonentagedie camina speichersteinanlagemandanten ein fhrendessucht auendienstmitarbeiter mw02062017sich dasals zuverlssigerber 110ber 100 gewerblichenunserhomeoffice alsmw gebudetechnikdirekt beiholensearch und erhhtentwickelt und produziertbewerberplanerberaterwenn sie alsvomber 80familienunternehmen mit berherstellerness duschrinneumfangreicheunternehmensnachfolgemitsubishi electric48mw fr denso sindsucht kundendienstmonteurteilverffentlicht diewormssanitrindustrie wir punktengewerblichendieser meldungmehr als 110begriffraum frentwicklungsstrategie in zusammenarbeitkaldewei werden bdergesamtservicesie auch weiterfester begriff dasunternehmen imdemwir punktenfrankfurt einbrtje gmbhmw nordrheinwestfalen sdmit denzur qualittskontrolleweiter 08062017seit bervon doymaratiopharm arenainnovative lftungssystemegmbh vorstellungsuche nachdie hygienische weitergroraum frankfurt familienunternehmenwirtschaftlichkeit umweltschutzmessgertfamilienunternehmen mitgebietsleiter mw projektgeschftplayerneue trikot derein unternehmen derstandort worms diefr deutschlandmittelstndischesberschritten5990sucht produktmanager mwzur innenraumabdichtungvertriebsmitarbeiter im auendienstfr dashydronic engineering suchtfhrendensanitrtechnik ist unserauendienstmitarbeiter mw mittesdost zurzeit untersttzenberuflichen netzwerk xingmanager mw zurzeitdichthppe suchtkontakten bei demqio untersttzt shkbetriebe09062017herz pelletskessel mitnichtsgmbh produktmanagerabgasanalysegertvon sanitrtechnikdienstleistung nachfolgeregelung02082017sucht junior verkaufsberatersucht geschftsfhrer maschinenbauder suche nachwir machengebietsverkaufsleiter mw badenwrttembergheizungstechnikmw aus demauch weiterthemenaufgabenstellung umfasst diemnchen ist einmarketingverbundgruppe weiterstartetunternehmen der internationaluntersttztrechnungauf drger2017 1700mw zuruntersttzen sie mitals bewerber daraufqualitt und funktionalittbleibenhat erstmalig diezeit weilstrom und wasser50hufig25 jahre erfahrungenbrunataweltweit erfolgreicherheizzentralen zurgebietsverkaufsleiter mwoventrop ist eineraktuelle trends beimw referenznummer 062017luft und klimatechniksmartvorbereitung weitereinesdas vormw zurzeiturban schlickum weiterspannendsten themenendlich52hargassnerweiter 25072017stehtgmbh ist3 personentageinnerhalb ihres weiterdas direktewannen exklusivekeineim bad weiterweiter 07082017ab lagerzeittechnisches knowhowmitarbeiter mwnutzen sievor hochwasserschdenhomeoffice designsoliditt einesecowrmerckgewinnung frqio untersttztsie ein20grndung vorjubilumssetprofisgroraum stuttgart homeofficeweitersiefachberaterknnenzeitraumesoder waschtischewatts industriesuntersprechensd zurzeituntersttzt shkbetriebe mitvon doyma weiterunternehmen mitfrankfurt uponordrngt die72drngtist judoweiter 19052017tgajudo suchtwerden auch siebereich systemtechnikhaustechnik suchtdoyma effektiverqualittskontrolleklimaluftungbermit einer ganzget nordzweidirect searchvertriebsmitarbeitergmbh anlagenmechanikermeisterinverantwortlicheweiter 29082017imi hydronicdiesem enormenregion frankfurteine einkaufssteht alsmw badenwrttembergfr weiterder marke aegberuflichen netzwerkmaschinenbau im groraumenergieneigentmergefhrtes mittelstndischeswerden bderdurch intensivenordhessen technisches knowhowweitereeuropischenwir sind einhppe gmbhsteht als weltweitsicherheitmit einemklickenpunktesystem fr ihrevorstellung 24hmessgerteserviceganz besonderen aktionschneider personalberatung suchtheizzentralenfr densterreichischer hersteller vonanlagenmechanikermeisterinmit nutzenschneider personalberatungvieleuponor istunternehmen wirbesonderen aktion auf3fachberater mwmittelstndisches unternehmenverstehen esgehrenhannover aktuellhaustechnikpersonal suchtzufallsanitrindustrie wirattraktiveproduktmanager wmaufgabenstellung sie bauenmonteureelementsthema energiewende diearbeitest dusich beishkbranche sucht gebietsverkaufsleiterweiter 17082017wir bei viega71komfortablerdoyma effektiver schutzweiter 14062017weiter die erfolgschancenpcshskgegen radon dichtungseinstzeerstmalig diehaustechnik auf derniederrheinbrtje sucht kundendiensttechnikerholen sie sichheizungs und sanitrtechnik30die haustechnik mitwater solutionsistneusssachsenmobilen heizzentralen zurvonvon vielennbsp mehrwerten700 mitarbeitern weiterlebeneinzigeim handwerks energiesucht mitarbeiterinpassendesucht verkaufsberatergehrt europaweit zupassende bewerberuponorvertriebsbeauftragteraktuellevielausdehnungsgefeals starkerarchitektendin 18534 komplettsetgebietsleiter sanitr mwdie shkbranchewir ein fhrendessauerlandgroraum frankfurt einunternehmen wennvakanzen zuweiter 23082017imi hydronic engineeringzurzeit untersttzen wirclage suchtweiter 14092017fhrenden europischenshkprojektleiterbrennwerttechnikfachgrohandelsyraktuell untersttzen wirpeinemann sohnnachfolgeregelungder saison weiterunsfhrende globale anbieterfrling sucht kundendiensttechnikerzielgruppenverbindetwir verstehenprojektleiter rltanlagenbau klimaluftunganbieter und spezialistpunktesystem frkln aachenenergieeffizienz wirtschaftlichkeitregion klnrohrleitungssysteme062017 imifamilienunternehmens mitpunkten mitschellgesamtservice fr diedie verantwortliche durchfhrungihresaustria emailsonnenkraft aufaugust brtjestandortbewhrtesauftragmit wrmerckgewinnungdas bad direktaus demgebietsleiter auendienstmitarbeiterunseren mandanten einmrkte mit nutzenweyland sucht auendienstmitarbeiterhatunserermw handelhandwerk freiner von vielennbspnordrheinwestfalen sdder markeweyland bietet stelleinnovative fachhandwerkerherzterminmit digitalsteuerung von projektenseinenstandort attendorn seittreten gesundheitsgefhrdende gasekurzen29austriader weiter 25082017sanitrfachhelfer frden ortsexklusive handwerkeraktion vomklimatechnik suchtinnenraumabdichtungmchten klicken siefr thermondo61sucht fachberater mwfamilienunternehmenslftung fraktuellenstandort brensbachtechnischerinnerhalb eines kurzenrechnung weitervernetztenenormen kontaktpotentialder weitermw dieob duschflchen badewannenerfolgschancen preisgnstig passende10 jahren44fr den bereichattendornifovon hackgut pelletsvierder grndung vormessgerteservicegrundfossucht planerberater mwweitere detailinfos zuinnovativ und gestaltenkarriereseite desinnovationsfhrer weiterdeutschlandsweiter 20072017brtje sucht technischenab sofort directultraaus derbieten hat hiermit den zweigniederlassungen3302 lxklima und prozessanlagenbauen denlagerhaustechnik mitneueswir ein1080 badenwrttemberg mittewest60 jahre testowrmestundenverrechnungssatzhomeoffice energieeffizienzhundertformatverkuferim auendienst mwangebotsaktionsowie alsbrensbach fhrungsaufgabenihres weitersucht gebietsverkaufsleiterdie logos interessanter04092017destatiswartetdirekt bei demstiebelbewerber fr ihrekontakten beieigentmergefhrtesmw badenwrttemberg sdostumfasst dieshkinnovativer und komfortablerist weiterhochwasserschdenprodukte sindpelletssanitr heizung klimaonlinemetallshkbranchefr ihrefrankfurthaustechnik rckstausystemestckholzheizungen im weiteres unseresucht produktmanagersucht verstrkung kundendiensttechnikerweltweit fhrendenw schneidermangehaltmuttergesellschaft fr weiterdas denimmitarbeiterinnen haben unsbadmbelhomeoffice als internationalershkprojektleiter mit einemmeldung habenhersteller innovativersucht fr germannsucht gebietsleiteruntersttzt shkbetriebezehnderneuen servicekonzeptes weitersucht technikerexklusiveuns arbeitestaussendienst frzielinternational aufgestellten bdreiner premiumgroraumweiter 18082017lftungssysteme mitdie haustechnikhier weiterbietet hierfindetangedachten zeit weilwirfhrende spezialist von03082017direkt mit dernachfolgeregelung in ihrem21programmdas vor beraufgabenstellungwm trinkwassersystemehaustechniknachfolge bietet densteuerung vonsales managerduein sterreichischer herstellerformat wannen47vernetzten mobilenkleinschmidt gmbh angebotsaktionalles dichteinem gehalt dasprojekten mitpumpenvertriebsmitarbeiterin aussendienst frjeweiligenist unser mandantgroraum stuttgartenergieeffizienz wirtschaftlichkeit umweltschutzludwigsfeldefr die60 jahreder wasseraufbereitung weitervom 18weiter 21072017erstes ehhwirtschaftlichmw referenznummerbderspeziell fr diesie sonnenkraftdicht mittretenist unserist onlineprozessanlagenmit einem gehaltecombder ausbewhrtes konzeptspezialist von weiterinnovationsfhrernorm din 18534jahren ist judojetztpartner voneinerfhrenden unternehmendas teamsucht vertriebsbeauftragterinteresse direkt beibafa bundersteshandelhandwerk frzu weiterals internationaler herstellertesto 3302 lxdienstleistungzu bietenludwigsfelde die deinzernrw region klnews 1301 unseraegprodukte fr innovative1700 uhrsparen unser auftraggebersales manager mwspezialist fr hydronischethema energiewendedas istweiter 25042017unserer mitarbeiterinnen habenweiter 27072017sucht verstrkungfhrenden herstellernim auendienstverlassenfhrenden herstellern der110 jahren wirservicetechniker biomasseheizungendichtungseinstzeeffizientmw mitte zurzeitdie gabag flexzargeim innendienstkaldeweiduschrinne neuhaustechnik sucht vertriebsmitarbeiterinsystemen frweiter 25082017haustechnik kurzcamina einheizungssymposium zummandant ist iminnovationen und diemitsubishirihovorden groraumkurzzeitraumes groe11vielennbsp mehrwertenfr die zielgruppender neuenlieblingsverein und holensofortsucht projektberaterbesuchen siegehalt das denvertriebsgebietsie bauen denist derist im groraumpluggit entwickeltvon projektendeinzer weyland suchterstenals 110referenznreinemstromwerden durchmw groraumdem beruflichenber 25 jahreder lohnfertigung ewsheizzentralen zur mietesind ein fachgrohandeldichtungseinstze von doymaauch frschweizihren lieblingsvereinunsere produkte sind14heizung klimaist einerpreisgnstig passende bewerbersdostmit 10sucht mitarbeiterin impluggitdem m3bbadplanerbietet hier weiterwieder einmal drngt4sanitrtechniknachfolgeregelung 1 umfangreicheanzahlpfalzuntersttzen siemit formatder fhrenden unternehmeneiner premium weiterregionenzweigniederlassungen ghoffmannsie unszahlreiche neuheitenseptember 2017 weiterder haustechnikmw handelhandwerk60 jahren gegrndeteauendienstmitarbeiter mw frthemen im handwerksreferenznr 1080 badenwrttembergkannuhr weiterinnovative fachhandwerker herzsucht auendienstmitarbeiterwasser wrmepumpe abfhrenden herstellern innovativerdsseldorfmwdie weiter 08092017der fhrendedieser35auf dem gebiet08062017zuverlssigerbereich systemtechnikhaustechnik bei13haustechnikpersonal verffentlicht diepartner von industriehandwerksersteeineuns weitererhhtehhweiter 16062017durchfhrung und steuerungweiter diewir suchenvertrauenmanagerumweltfreundlicher weitergebudetechnikmaguswartet wiederunberhrte naturfhrendermarke aeg zuvon hskeckeunternehmen unserkomfortabler weiterverkaufsberater mw fr62radon dichtungseinstzehamburghaustechnikpersonal leistetmit digital vernetzten30082017 neuesucht gebietsleiter mwinstallationszurzeit untersttzenjuniorwiezur mietemobilekaldewei werden43kurzen zeitraumesaufgabenstellung sie110 jahren verbindetinteressanter unternehmen wennwerworkshopsarea sales managerindadie erfolgschancen preisgnstigbei interesse direktdie erfolgschancen1700 uhr weiterverstrkung kundendiensttechnikerghoffmannhafurt odervon haustechnikpersonalversorgungstechnikziplessstuttgart referenznr 1071nachfolgeregelungenshkbranche sucht gebietsleitermit sitzsie weitere detailinfosaktion auf werden80 jahren istmw gebudesystemtechnikihrem unternehmen unserfhrungsaufgaben in dermagische anzahlstuttgart homeoffice vielfr uponorhaustechnikpersonal leistet abkomplettset badbereich dichtfunktionalitt unser mandanttechnikerin shk standortbadewannenihre dienstleistung nachfolgeregelungsie suchenim messgerteserviceim innendienst frmittefr den standortunternehmen dersommerdie zukunfterfolgreicher weiterstandorte hafurt0haustechnikpersonal profitierengmbh anlagenmechanikermeisterin oderarmaturen und systemenheizungsder sanitrindustrie wirder karriereseiterauchmeldermontagenvon diesem enormenalle dieist einihraugsburgxing berschrittenbei der suchefachberater mw imgehrt in europa100 gewerblichenhomeein fhrendesdem gebiet derwatts industries europezuverlssige industriehandelsvertretungaeg zu dengesamtservice frbrandschutzgrndungvorreiter aufindustries europeneue format wannenbieten hatfr hamburgschell sucht mitarbeiterauf derals starker partnerim auftrag54gmbh fachhelferunsere weitermehr weiterinnendienst frkurz mah isteinmal mit einervom verkufer angedachteneiner derauchsofort werdenseriees unsere weitererfahrungenservicetechnikerkarriereseite des jeweiligenlieferbarzahlreiche innovationennorm dinthermeagruppereferenznummer 062017hannover aktuell untersttzenfhrenden hersteller imdas vertriebsgebietleicht58ab 5990thermeagruppe mit weiterabgleichmittwochihre vakanzenhsk prsentiert zahlreicheshkbranche beiformat wannen exklusiveden praxisfortschritt derdie motivationmandant stehtwaschtische mitweiter 11092017mehrgmbh mit dendin 185341989 zweiseptember 2017systemtechnikhaustechnik beiunternehmensnachfolge leider scheiternbetreuungmeldung32keucomnchen istbei das badbietet denviele nachfolgeregelungenfrankfurt uponor istjunior verkaufsberater mwweyland gmbh mitkontaktpotential mit einersich bei interesseverbunden und knnenberlasse nichts dem1077 nrweines neuen servicekonzeptesregion bremenzu 3wartet wieder einmalbdr thermeagruppesearchmefaquerschiesserbadenwrttemberg sdost zurzeitoktoberprzision qualittim handwerkshaben mchten klickenviel bewegenhochwasserschden tretenmitarbeiternschutz gegen radonworms dieortsneu allessucht servicetechnikererfolgreicherbetriebsanalyse und vorbereitungewskommen siemarke aegflssigkeitskonditionierungoktober 2017nutzen sie ihreprfbonuswilogebietsverkaufsleiter mw nordrheinwestfalendigital vernetzten mobilenjahre erfahrungen imschlickkonzeptindustrievertrauen sieheizungsinstallation regionmengen von niederschlagdie zielgruppensind eintechnischesauch sieder saisonxing berschritten kundeneinmal drngt diecommothermder spannendstenauf kann esmit ber 700ein eigentmergefhrtes mittelstndischesfr deutschland planungsuchenbremenbis zu 3weiter 12092017trikot derden zweigniederlassungenvorbereitungauendienstsie sonnenkraft aufdurch einegehrt europaweitim weiterp11rosenheimhaustechnik rckstausysteme schtzenniederschlag aufzeigen3092017 untersttzen siezusammenarbeit mit derfinden abhaustechnikpersonal verffentlicht25 jahreproduktmanager18534 komplettset badbereichfr das verkaufsgebietewaldber 25vonnbspfr badenwrttembergentwicklungsstrategieber weiterarbeitestunserer mitarbeiterinnenplanerberater wrmeverteilungbafadie weiterdoyma startetbitteverkufer angedachtenkundendiensttechniker mw grorauminnovativ das sindstandort brensbach fhrungsaufgabendem beruflichen netzwerkwegwimtec ocean p112017 weiterinteresse direktmessgerteservice fhrten zursind innovativplanung und umsetzungfachhandwerker herzim bereich systemtechnikhaustechnikeines der fhrendenberlasseneuulmspezialist frein weiterentwicklungoder waschtische mitgetmit universalgehren wir miterhaltenist imsalesextrem110 jahrenhat erstmaligwhler vestrategien ein zielpreisgnstigdie zielgruppen architektenvertriebsmitarbeiterin aussendienstauftraggeber istbadbereichcaminajahresaisonvorreiter auf demunseren mandanten beizeitraumes groe mengenumweltfreundlicherdie deinzer weylandleistet ab sofortkgww personalklicken sieberuflichenspannendsten themen imder entwicklungsstrategieaugustprodukte sind innovativdezemberbereich derseinewiederstarker partnerverffentlichtist einer vonmandant mitsind sie36team von haustechnikpersonalfhrten zur entwicklungscheitern vieledas gebietstuttgart referenznrgebietsleiter mw handelhandwerkoemfr profisingenieurvon niederschlag aufvenochindustrie und weiterder shkbranche beifr das vertriebsgebietgmbh angebotsaktion 60geschftsfhrer maschinenbauproduktsucht kundendiensttechnikerbremen diedie logoseuropesucht vertriebsmitarbeiterin aussendienstuntersttzen wir einden fhrenden unternehmenschneider hatfhrende spezialistjahrzehntentechniker norddeutschland mwgesundheitsgefhrdende gasegersthofenimiim bereich derentwicklung einesmw rohrleitungssysteme metallsucht vertriebsmitarbeiter mwweiter 28082017wrmerckgewinnung fr weiterliefertaufgestelltenprsentiertinnovative lftungssysteme mitherz pelletskesselhandwerks energieheizenemailwlderpersonalberatung sucht geschftsfhrerkontaktpotential mitpreisgnstig passende1071 groraum stuttgartthermeagruppe mitweiter 10052017visionsie weitereklicken sindsonnenkraft auf derinnovativer und umweltfreundlicherwm trinkwassersysteme standortedeutschensucht serviceauendienst mwein ziel mehrtechnisches knowhow zahlreichevon hackgutmarketingverbundgrupperltanlagenbautreten innerhalb einessucht produkttechnikerhppeglobal playereines familienunternehmens mitmw zurzeit untersttzenneuen servicekonzeptesmarkenservice direkt ab34weiter 01082017global water solutions062017standort in gersthofenheiztechniksie alsmw projektgeschft64aircleanweiter 02062017jahrpersonalberatung suchtunser mandant istder spannendsten themenmw fr unserenhaustechnik kurz mahdoyma weitermandant als weitersystemsystemenbesonderen aktionhaustechnik mit weiterfachbereichpelletskesseldigitalkann es durch

Longtail Keyword Density for Shk-journal.de

KeywordsOccurences
fhrendes unternehmen der36
unternehmen der shk-branche33
ewald w schneider31
haustechnikpersonal sucht fr25
zurzeit untersttzen wir25
sucht gebietsleiter mw25
ww personal sucht23
fr die region23
bei der suche22
mw fr die21
ein fhrendes unternehmen20
motivation unserer mitarbeiterinnen19
technisches know-how zahlreiche19
personal sucht gebietsleiter19
die motivation unserer19
hersteller im bereich19
know-how zahlreiche innovationen19
innovationen und die19
mitarbeiterinnen haben uns17
unserer mitarbeiterinnen haben17
untersttzen wir unseren17
haben uns weiter17
wir unseren mandanten17
der shk-branche sucht17
ist einer der16
aktuell untersttzen wir16
wir einen fhrenden15
einen fhrenden hersteller15
shk-branche bei der15
mw fr den15
untersttzen wir einen15
der shk-branche bei15
bei der weiter14
w schneider personalberatung14
wir sind ein14
unseren mandanten ein13
mandanten ein fhrendes13
der suche nach13
sucht auendienstmitarbeiter mw13
deinzer weyland gmbh13
im bereich luft-12
luft- und klimatechnik12
suche nach einem12
einer der fhrenden12
gmbh mit den11
fr das gebiet11
wolf ist weiter11
weyland gmbh mit11
schlick und wolf11
deinzer weyland sucht11
den zweigniederlassungen ghoffmann11
die deinzer weyland11
mit den zweigniederlassungen11
ghoffmann urban schlick11
zweigniederlassungen ghoffmann urban11
shk-branche sucht gebietsleiter10
schneider personalberatung sucht10
mw im auendienst10
fhrenden hersteller im10
fhrender hersteller im9
untersttzen wir ein9
sucht kundendiensttechniker mw9
der suche weiter9
zu den fhrenden9
fhrenden hersteller von9
sie sich das8
trikot der saison8
sich das neue8
das neue trikot8
neue trikot der8
testo 330-2 lx8
personalberatung sucht geschftsfhrer8
holen sie sich8
fr den groraum8
w schneider hat8
der saison weiter8
3092017 untersttzen sie8
exklusive handwerkeraktion vom8
handwerkeraktion vom 188
wannen exklusive handwerkeraktion8
lieblings-verein und holen8
ist der fhrende8
neue format wannen8
vom 18 30920178
format wannen exklusive8
mit format ihren8
format ihren lieblings-verein8
18 3092017 untersttzen8
sie mit format8
untersttzen sie mit8
sie als bewerber8
wir ein fhrendes7
nach einem weiter7
fachgrohandel fr gebudetechnik7
der fhrenden europischen7
frling ist einer7
sucht gebietsverkaufsleiter mw7
kundendiensttechniker mw fr7
gabag flexzarge schnittschutz7
das bad direkt7
innovativer und umweltfreundlicher7
mit uns arbeitest7
uns arbeitest du7
du an einem7
der spannendsten themen7
ist unser mandant7
fr kesselheld gmbh7
mw zurzeit untersttzen7
fhrender hersteller von7
sucht fr kesselheld7
spannendsten themen im7
einem der spannendsten7
kleinschmidt gmbh vorstellung7
themen im handwerks-7
europischen hersteller innovativer7
fhrenden europischen hersteller7
energie- und weiter7
im handwerks- energie-7
als starker partner6
gebudetechnik der als6
mittelstands- allianz haustechnik6
imi hydronic engineering6
fr gebudetechnik der6
partner von industrie6
der als starker6
im groraum frankfurt6
ein fachgrohandel fr6
starker partner von6
industrie und weiter6
im bereich der6
wlder und unberhrte6
mnchen ist ein6
mw projekte fr6
gebietsleiter mw projekte6
werden auch sie6
brunata mnchen ist6
im auendienst fr6
mw fr das6
windhager sucht verstrkung6
kleinschmidt gmbh angebotsaktion6
eigentmergefhrtes mittelstndisches unternehmen6
ein eigentmergefhrtes mittelstndisches6
ist ein eigentmergefhrtes6
mittelstndisches unternehmen mit6
2017 1700 uhr6
gmbh ist ein6
1700 uhr weiter6
fr den bereich6
hat hier weiter6
den fhrenden herstellern6
im bereich systemtechnikhaustechnik6
sucht produktmanager mw6
deinzer und weyland6
sind ein fachgrohandel6
klimatechnik bei der6
unberhrte natur sind6
natur sind nicht6
zu bieten hat6
bieten hat hier6
sauerland zu bieten6
das sauerland zu6
sind nicht das6
nicht das einzige6
einzige was das6
magische anzahl von5
anzahl von 100005
kontakten bei dem5
dem beruflichen netzwerk5
beruflichen netzwerk xing5
netzwerk xing berschritten5
bei dem beruflichen5
die magische anzahl5
von 10000 kontakten5
10000 kontakten bei5
von hackgut- pellets-5
lsungen fr die5
ist ein sterreichischer5
xing berschritten kunden5
weyland bietet stelle5
bietet stelle als5
ein sterreichischer hersteller5
sterreichischer hersteller von5
hat erstmalig die5
schneider hat erstmalig5
hersteller von hackgut-5
erstmalig die magische5
sucht projektberater mw5
als weltweit erfolgreicher5
steht als weltweit5
weltweit erfolgreicher weiter5
kundendiensttechniker mw groraum5
homeoffice viel bewegen5
mandant steht als5
unser mandant steht5
homeoffice design przision5
gebietsleiter mw projektgeschft5
design przision qualitt5
qualitt und funktionalitt5
funktionalitt unser mandant5
viel bewegen strom5
strom und wasser5
spezialist von weiter5
fhrende spezialist von5
im auendienst mw5
unsere produkte sind5
pellets- und stckholzheizungen5
der fhrende spezialist5
auftraggeber ist der5
stckholzheizungen im weiter5
wasser sparen unser5
sparen unser auftraggeber5
unser auftraggeber ist5
produkte sind innovativ5
innovativ und gestalten5
hargassner ist ein5
kontaktpotential mit einer5
mit einer premium5
einer premium weiter5
auendienstmitarbeiter mw fr5
enormen kontaktpotential mit5
diesem enormen kontaktpotential5
von haustechnikpersonal profitieren5
haustechnikpersonal profitieren von5
profitieren von diesem5
von diesem enormen5
kesselheld gmbh fachhelfer5
gmbh fachhelfer fr5
planung und umsetzung5
installations- und heiztechnik5
praxisfortschritt der mrkte5
den praxisfortschritt der5
gestalten den praxisfortschritt5
der mrkte mit5
mnchen brunata mnchen5
fachhelfer fr heizungsinstallation5
fr heizungsinstallation region5
auendienst mw fr5
der fhrenden hersteller5
berschritten kunden von5
kunden von haustechnikpersonal5
als internationaler hersteller5
internationaler hersteller der5
homeoffice als internationaler5
mitte-west homeoffice als5
1080 baden-wrttemberg mitte-west5
baden-wrttemberg mitte-west homeoffice5
hersteller der heizungs-5
sanitrtechnik ist unser5
mandant als weiter5
einer ganz besonderen5
unser mandant als5
mit einer ganz5
einmal mit einer5
referenz-nr 1080 baden-wrttemberg5
gebudetechnik referenz-nr 10805
innovative fachhandwerker herz5
shk-branche sucht gebietsverkaufsleiter5
fr innovative fachhandwerker5
produkte fr innovative5
gebietsleiter mw gebudetechnik5
mw gebudetechnik referenz-nr5
herz wartet wieder5
wartet wieder einmal5
herz attacke innovative5
ber 25 jahre5
wieder einmal mit5
attacke innovative produkte5
innovative produkte fr5
ganz besonderen aktion5
heizungs- und sanitrtechnik5
besonderen aktion auf5
ab 5990- herz5
wrmepumpe ab 5990-5
luft wasser wrmepumpe5
wasser wrmepumpe ab5
commotherm luft wasser5
sie innovationsfhrer weiter5
5990- herz wartet5
aktion auf werden5
herz commotherm luft5
fachhandwerker herz commotherm5
auf werden auch5
auch sie innovationsfhrer5
verffentlicht die logos4
haustechnikpersonal verffentlicht die4
direkt bei dem4
bei dem unternehmen4
sind ein weiter4
zur qualittskontrolle der4
mw zur qualittskontrolle4
dem unternehmen bewerben4
qualittskontrolle der rauchmelder-montagen4
interesse direkt bei4
ber 700 mitarbeitern4
mit ber 7004
unternehmen mit ber4
700 mitarbeitern weiter4
interessanter unternehmen wenn4
mit der karriereseite4
der karriereseite des4
karriereseite des jeweiligen4
des jeweiligen unternehmens4
kundendienstmonteur mw zur4
direkt mit der4
klicken sind sie4
darauf klicken sind4
sind sie direkt4
sie direkt mit4
jeweiligen unternehmens verbunden4
verbunden und knnen4
unternehmen wir sind4
wenn sie als4
unternehmen wenn sie4
logos interessanter unternehmen4
als bewerber darauf4
bewerber darauf klicken4
knnen sich bei4
sich bei interesse4
bei interesse direkt4
die logos interessanter4
standort brensbach fhrungsaufgaben4
weltweit fhrenden anbieter4
fhrenden anbieter von4
der weltweit fhrenden4
einer der weltweit4
uponor ist einer4
anbieter von systemen4
systemen und lsungen4
der weiter 250820174
riho sucht fr4
die hygienische weiter4
fr die hygienische4
frankfurt uponor ist4
oder frankfurt uponor4
uponor gmbh produktmanager4
fr uponor gmbh4
sucht fr uponor4
wimtec ocean e104
gmbh produktmanager wm4
produktmanager wm trinkwassersysteme4
hafurt oder frankfurt4
standorte hafurt oder4
trinkwassersysteme standorte hafurt4
wm trinkwassersysteme standorte4
ltw mnchen kg4
gebietsleiter mw handelhandwerk4
shk-projektleiter mit einem4
als shk-projektleiter mit4
sowie als shk-projektleiter4
kundenberatung sowie als4
mit einem gehalt4
einem gehalt das4
auendienst fr das4
den orts- weiter4
das den orts-4
gehalt das den4
der kundenberatung sowie4
fhrungsaufgaben in der4
germann gmbh anlagenmechaniker-meisterin4
fr germann gmbh4
sucht fr germann4
mw handelhandwerk fr4
gmbh anlagenmechaniker-meisterin oder4
anlagenmechaniker-meisterin oder technikerin4
unternehmen bewerben das4
shk standort brensbach4
technikerin shk standort4
oder technikerin shk4
sucht kundendienstmonteur mw4
einer von vielennbsp4
fr den neuen4
im bad weiter4
den neuen standort4
standort in gersthofen4
gersthofen technisches know-how4
vernetzten mobilen heizzentralen4
oventrop ist einer4
systemen fr die4
fr die haustechnik4
armaturen und systemen4
hersteller von armaturen4
digital vernetzten mobilen4
ab werk weiter4
direkt ab werk4
jahre erfahrungen im4
25 jahre erfahrungen4
erfahrungen im messgerteservice4
im messgerteservice fhrten4
messgerteservice fhrten zur4
24h-messgerteservice fr abgasmessgerte4
vorstellung 24h-messgerteservice fr4
markenservice direkt ab4
brtje sucht kundendiensttechniker4
herz pelletskessel mit4
gmbh vorstellung 24h-messgerteservice4
die haustechnik mit4
sucht verkaufsberater mw4
haben mchten klicken4
mchten klicken sie4
meldung haben mchten4
dieser meldung haben4
zu dieser meldung4
klicken sie bitte4
sie bitte mehr4
sucht verstrkung kundendiensttechniker4
verstrkung kundendiensttechniker mw4
sie verlassen weiter4
mehr sie verlassen4
bitte mehr sie4
detailinfos zu dieser4
weitere detailinfos zu4
mw hargassner ist4
60 jahre testo4
sucht service-techniker biomasseheizungen4
hargassner sucht service-techniker4
mit digital vernetzten4
fr das vertriebsgebiet4
aquis sanitr ag4
sie weitere detailinfos4
wenn sie weitere4
frling sucht kundendiensttechniker4
unternehmen im bereich4
fhrten zur entwicklung4
zur entwicklung eines4
zusammenarbeit mit der4
mit der muttergesellschaft4
entwicklungsstrategie in zusammenarbeit4
umsetzung der entwicklungsstrategie4
fr deutschland planung4
der muttergesellschaft fr4
muttergesellschaft fr weiter4
oder waschtische mit4
waschtische mit kaldewei4
badewannen oder waschtische4
duschflchen badewannen oder4
ob duschflchen badewannen4
heiztechnik fr deutschland4
sucht geschftsfhrer installations-4
von vielennbsp mehrwerten4
vielennbsp mehrwerten vonnbsp4
flexzarge schnittschutz ist4
ist einer von4
das ist einer4
mehrwerten vonnbsp haustechnikpersonal4
vonnbsp haustechnikpersonal so4
als bewerber weiter4
sind sie als4
so sind sie4
haustechnikpersonal so sind4
mit kaldewei werden4
kaldewei werden bder4
familienunternehmens mit weiter4
standort worms die4
eines familienunternehmens mit4
soliditt eines familienunternehmens4
sicherheit und soliditt4
worms die deinzer4
produziert und vertreibt4
entwicklung eines neuen4
eines neuen servicekonzeptes4
neuen servicekonzeptes weiter4
mw wasser wlder4
viega die sicherheit4
verbindet viega die4
sucht vertriebsmitarbeiter mw4
unseren mandanten bei4
aus einheitlicher weiter4
bder aus einheitlicher4
werden bder aus4
mandanten bei der4
mw rohrleitungssysteme metall4
jahren verbindet viega4
110 jahren verbindet4
ber 110 jahren4
seit ber 1104
bewerben das ist4
fr den standort4
sanitr heizung klima4
personalberatung seit 19894
schneider personalberatung seit4
direkte und weiter4
330-2 lx jubilums-set4
lx jubilums-set 14
judo sucht fachberater4
nord-hessen technisches know-how4
aufgabenstellung sie bauen4
personentage in das4
zu 3 personentage4
durch das team4
werden durch das4
sofort werden durch4
das team von4
team von haustechnikpersonal4
bis zu 34
haustechnikpersonal bis zu4
von haustechnikpersonal bis4
sucht fachberater mw4
fachberater mw im4
dem gebiet der4
auf dem gebiet4
vorreiter auf dem4
gebiet der wasseraufbereitung4
der wasseraufbereitung weiter4
die gabag flexzarge4
gebietsleiter sanitr mw4
oktober 2017 17004
der vorreiter auf4
judo der vorreiter4
grndung vor ber4
der grndung vor4
seit der grndung4
vor ber 804
ber 80 jahren4
ist judo der4
jahren ist judo4
80 jahren ist4
ab sofort werden4
finden ab sofort4
die zielgruppen architekten4
leistet ab sofort4
haustechnikpersonal leistet ab4
fr die zielgruppen4
lftung fr die4
vasco sucht planerberater4
sucht planerberater wrmeverteilung4
wrmeverteilung und lftung4
innerhalb ihres weiter4
architekten und fachplaner4
den kundenstamm durch4
bauen den kundenstamm4
sie bauen den4
kundenstamm durch intensive4
durch intensive betreuung4
betreuung innerhalb ihres4
die aufgabenstellung sie4
intensive betreuung innerhalb4
nichts dem zufall4
berlasse nichts dem4
passende bewerber fr4
preisgnstig passende bewerber4
erfolgschancen preisgnstig passende4
bewerber fr ihre4
fr ihre vakanzen4
zu finden ab4
vakanzen zu finden4
ihre vakanzen zu4
die erfolgschancen preisgnstig4
weiter die erfolgschancen4
mit dem weiter4
fr die weiter4
wimtec ocean p114
ab sofort direct4
sofort direct search4
damit weiter die4
erhht damit weiter4
search und erhht4
sucht gebietsleiter sanitr4
whler ve 2004
seit mehr als4
sucht mitarbeiterin im4
haustechnik auf der4
ess duschrinne neu4
energieeffizienz wirtschaftlichkeit umweltschutz3
heizzentralen zur miete3
mobilen heizzentralen zur3
nachfolgeregelung in der3
ihre dienstleistung nachfolgeregelung3
unternehmensberatung ewald w3
schneider hat ihre3
hat ihre dienstleistung3
zur miete die3
kundendienst-techniker mw fr3
gebietsleiter auendienstmitarbeiter mw3
niederrhein homeoffice energieeffizienz3
aachen niederrhein homeoffice3
kln aachen niederrhein3
homeoffice energieeffizienz wirtschaftlichkeit3
sucht fr thermondo3
fhrendes unternehmen im3
die unternehmensberatung ewald3
2017 weiter 080920173
die weiter 080920173
dichtungseinstze von doyma3
september 2017 weiter3
kofen sucht einen3
gehrt in europa3
europa zu den3
entwickelt und produziert3
bad direkt weiter3
der ratiopharm arena3
profis fr profis3
radon dichtungseinstze von3
fhrenden herstellern innovativer3
innovativer und komfortabler3
neu-ulm aktuelle trends3
neuheiten in neu-ulm3
gebietsverkaufsleiter mw baden-wrttemberg3
von doyma weiter3
aktuelle trends bei3
trends bei das3
flssigkeitskonditionierung in heizungs-3
klima- und prozessanlagen3
bei das bad3
projekten mit dem3
fr die verkaufsregion3
baden-wrttemberg sd-ost zurzeit3
europaweit zu den3
gehrt europaweit zu3
gmbh gehrt europaweit3
fhrenden herstellern der3
herstellern der sanitrindustrie3
punkten mit weiter3
wir punkten mit3
sanitrindustrie wir punkten3
der sanitrindustrie wir3
hppe gmbh gehrt3
die hppe gmbh3
sales manager mw3
prsentiert zahlreiche neuheiten3
area sales manager3
sucht area sales3
manager mw zurzeit3
punktesystem fr ihre3
fachplaner tga die3
gebietsleiter mw gebudesystemtechnik3
tga die aufgabenstellung3
mw gebudesystemtechnik referenz-nr3
gebudesystemtechnik referenz-nr 10773
mit wrmerckgewinnung fr3
lftungssysteme mit wrmerckgewinnung3
innovative lftungssysteme mit3
vertreibt innovative lftungssysteme3
wrmerckgewinnung fr weiter3
viega sucht produktmanager3
gegen radon dichtungseinstze3
der fhrenden unternehmen3
eines der fhrenden3
region kln aachen3
pluggit entwickelt produziert3
wir wollen wachsen3
nrw region kln3
1077 nrw region3
referenz-nr 1077 nrw3
wollen wachsen sie3
wachsen sie auch3
hannover aktuell untersttzen3
fr hannover aktuell3
sie auch weiter3
mw baden-wrttemberg sd-ost3
schutz gegen radon3
industries europe bv3
brunata sucht kundendienstmonteur3
sucht vertriebsmitarbeiter im3
oventrop sucht vertriebsmitarbeiter3
vertriebsmitarbeiter im auendienst3
watts industries europe3
anbieter und spezialist3
spezialist fr hydronische3
fr hydronische weiter3
projektleiter rltanlagenbau klima-luftung3
rltanlagenbau klima-luftung mw3
mw in bremen3
sucht junior verkaufsberater3
junior verkaufsberater mw3
verkaufsberater mw groraum3
aufgabenstellung umfasst die3
personal sucht junior3
shk-betriebe mit digital3
bremen die aufgabenstellung3
die aufgabenstellung umfasst3
rauchmelder-montagen in mnchen3
fhrende globale anbieter3
der fhrende globale3
mit nutzen sie3
mrkte mit nutzen3
verkaufsberater mw fr3
norddeutschland mw referenznummer3
nutzen sie ihre3
techniker norddeutschland mw3
engineering sucht service3
hydronic engineering sucht3
service techniker norddeutschland3
sie ihre weiter3
haustechnik mit weiter3
unser mandant mit3
referenznummer 062017 imi3
062017 imi hydronic3
hydronic engineering ist3
engineering ist der3
sohn projektleiter rltanlagenbau3
peinemann sohn projektleiter3
mw referenznummer 0620173
sucht fr peinemann3
fr peinemann sohn3
umfasst die verantwortliche3
bereich systemtechnikhaustechnik sucht3
schell sucht mitarbeiter3
systemtechnikhaustechnik bei der3
die camina speicherstein-anlage3
doyma effektiver schutz3
bereich systemtechnikhaustechnik bei3
familir und innovativ3
wir bei viega3
sind wir bei3
das sind wir3
innovativ das sind3
effektiver schutz gegen3
stuttgart homeoffice viel3
abgas-analysegert testo 330-23
klimatechnik sucht auendienstmitarbeiter3
angebotsaktion 60 jahre3
sucht service techniker3
qio untersttzt shk-betriebe3
untersttzt shk-betriebe mit3
mitte zurzeit untersttzen3
mw mitte zurzeit3
auendienstmitarbeiter mw mitte3
bei viega seit3
viega seit mehr3
durchfhrung und steuerung3
steuerung von projekten3
sucht planerberater mw3
planerberater mw zurzeit3
stuttgart referenz-nr 10713
groraum stuttgart referenz-nr3
systemtechnikhaustechnik sucht planerberater3
die verantwortliche durchfhrung3
mw groraum stuttgart3
referenz-nr 1071 groraum3
1071 groraum stuttgart3
jahren wir verstehen3
110 jahren wir3
als 110 jahren3
mehr als 1103
wir verstehen es3
verstehen es unsere3
groraum stuttgart homeoffice3
von projekten mit3
es unsere weiter3
gmbh angebotsaktion 603
sucht vertriebsmitarbeiter-in aussendienst3
nachfolgeregelungen in der3
der vom verkufer3
scheitern viele nachfolgeregelungen3
leider scheitern viele3
unternehmensnachfolge leider scheitern3
vom verkufer angedachten3
verkufer angedachten zeit3
er viele weiter3
weil er viele3
zeit weil er3
angedachten zeit weil3
schneider unternehmensnachfolge leider3
w schneider unternehmensnachfolge3
fr das verkaufsgebiet3
nach norm din3
key account manager3
einkaufs- und marketingverbundgruppe3
norm din 185343
die region bremen3
mitarbeiterin im innendienst3
im innendienst fr3
fr alle die3
mw fr unseren3
sie sonnenkraft auf3
besuchen sie sonnenkraft3
10 jahren garantie3
jahren garantie weiter3
mit 10 jahren3
dicht mit 103
badbereich dicht mit3
global water solutions3
mit dem m3bbadplaner3
klimatechnik sucht area3
weyland sucht auendienstmitarbeiter3
gmbh angebotsaktion drger3
mit universal prfbonus3
komplettset badbereich dicht3
18534 komplettset badbereich3
sauerstoffmangel auf drger3
auf drger bietet3
drger bietet hier3
bietet hier weiter3
sowie sauerstoffmangel auf3
dmpfe sowie sauerstoffmangel3
din 18534 komplettset3
hufig treten gesundheitsgefhrdende3
treten gesundheitsgefhrdende gase3
gase und dmpfe3
ist eine einkaufs-3
mah ist eine3
1 umfangreiche betriebsanalyse3
betriebsanalyse und vorbereitung3
nachfolgeregelung 1 umfangreiche3
conti sanitrarmaturen gmbh3
zur nachfolgeregelung 13
duschrinne neu alles3
neu alles dicht3
erstes ehh heizungs-symposium3
weiter 30082017 neue3
dicht nach norm3
alles dicht nach3
konzept zur nachfolgeregelung3
bewhrtes konzept zur3
gesamtservice fr die3
den gesamtservice fr3
bietet den gesamtservice3
haustechniknachfolge bietet den3
fr die nachfolgeregelung3
nachfolgeregelung in ihrem3
unser bewhrtes konzept3
unternehmen unser bewhrtes3
hsk prsentiert zahlreiche3
ihrem unternehmen unser3
ehh heizungs-symposium zum3
heizungs-symposium zum thema3
mw sanitr heizung3
grohandelskaufmann mw sanitr3
sucht grohandelskaufmann mw3
haustechnik sucht grohandelskaufmann3
heizung klima die3
klima die mittelstands-3
kurz mah ist3
haustechnik kurz mah3
allianz haustechnik kurz3
die mittelstands- allianz3
allianz haustechnik sucht3
sonnenkraft auf der3
die sonne schickt3
energiewende die sonne3
thema energiewende die3
zum thema energiewende3
sonne schickt uns3
schickt uns bekanntlich3
mah mittelstands- allianz3
keine rechnung weiter3
bekanntlich keine rechnung3
uns bekanntlich keine3
seit 1989 zwei3
1989 zwei strategien3
mit der marke3
ludwigsfelde die deinzer3
jahren gegrndete weiter3
60 jahren gegrndete3
ber 60 jahren3
wir mit der3
gehren wir mit3
aussendienst fr das3
bereich der haustechnik3
der haustechnik gehren3
haustechnik gehren wir3
vor ber 603
das vor ber3
mandant ist im3
unser mandant ist3
1301 unser mandant3
ews 1301 unser3
ist im groraum3
groraum frankfurt ein3
begriff das vor3
fester begriff das3
ein fester begriff3
frankfurt ein fester3
vertriebsmitarbeiter-in aussendienst fr3
schnittschutz ist die3
international aufgestellten bdr3
der international aufgestellten3
unternehmen der international3
ein unternehmen der3
aufgestellten bdr thermea-gruppe3
bdr thermea-gruppe mit3
standort attendorn seit3
sucht produkttechniker mw3
viega sucht produkttechniker3
thermea-gruppe mit weiter3
ist ein unternehmen3
brtje gmbh ist3
mw nordrhein-westfalen sd3
gebietsverkaufsleiter mw nordrhein-westfalen3
speziell fr die3
haustechnik sucht vertriebsmitarbeiter-in3
nordrhein-westfalen sd zurzeit3
sd zurzeit untersttzen3
august brtje gmbh3
die august brtje3
brtje sucht technischen3
sd-ost zurzeit untersttzen3
lohnfertigung ews 13013
der lohnfertigung ews3
kann es durch3
auf kann es3
es durch eine3
durch eine weiter3
fr ihre monteure3
niederschlag auf kann3
von niederschlag auf3
kurzen zeitraumes groe3
zeitraumes groe mengen3
groe mengen von3
mengen von niederschlag3
wieder einmal drngt3
einmal drngt die3
ziel mehr weiter3
ein ziel mehr3
strategien ein ziel3
zwei strategien ein3
aus dem raum3
heizungstechnikmw aus dem3
drngt die zeit3
windhager sucht vertriebsprofi3
sucht vertriebsprofi heizungstechnikmw3
vertriebsprofi heizungstechnikmw aus3
eines kurzen zeitraumes3
innerhalb eines kurzen3
maschinenbau im groraum3
geschftsfhrer maschinenbau im3
sucht geschftsfhrer maschinenbau3
marke aeg zu3
der marke aeg3
groraum frankfurt familienunternehmen3
ber 100 gewerblichen3
mit ber 1003
familienunternehmen mit ber3
frankfurt familienunternehmen mit3
aeg zu den3
den fhrenden unternehmen3
schtzen vor hochwasser-schden3
vor hochwasser-schden treten3
hochwasser-schden treten innerhalb3
treten innerhalb eines3
rckstau-systeme schtzen vor3
haustechnik rckstau-systeme schtzen3
fhrenden unternehmen wir3
fr hamburg aktuell3
hamburg aktuell untersttzen3
aco haustechnik rckstau-systeme3
attendorn seit ber3
fr die70
mw fr54
unternehmen der44
bei der43
weiter 2508201741
im bereich41
untersttzen wir41
fhrendes unternehmen39
weiter 0609201738
weiter 0809201735
weiter 2308201735
der shk-branche34
fr den34
weiter 1309201732
sucht gebietsleiter32
weiter 0109201732
w schneider31
ewald w31
weiter 1509201730
weiter 3008201730
sucht fr30
haustechnikpersonal sucht28
fr das28
gebietsleiter mw28
weiter 1808201726
zurzeit untersttzen25
hersteller von25
deinzer weyland24
personal sucht24
ist ein24
der weiter23
ww personal23
die region23
der suche22
kleinschmidt gmbh20
fhrenden hersteller20
ein fhrendes20
ist einer20
technisches know-how19
know-how zahlreiche19
zahlreiche innovationen19
uns weiter19
motivation unserer19
die motivation19
hersteller im19
unserer mitarbeiterinnen19
mit der19
mit den19
windhager sucht18
mit dem18
im auendienst18
fhrender hersteller17
mitarbeiterinnen haben17
wir unseren17
haben uns17
unseren mandanten17
shk-branche sucht17
unser mandant17
auendienstmitarbeiter mw17
einer der17
wir sind17
weiter 3108201717
weiter 2908201716
der fhrenden16
mit weiter16
aktuell untersttzen16
auf der16
wir einen15
sind ein15
einen fhrenden15
ist der15
shk-branche bei15
sucht auendienstmitarbeiter14
ist weiter14
schneider personalberatung14
mandanten ein13
kundendiensttechniker mw13
mw groraum13
weiter 0509201713
weyland gmbh13
die weiter13
sie sich13
suche nach13
bereich luft-12
weiter 1409201712
weyland sucht12
weiter 1109201712
nach einem12
fr weiter12
mw im12
viega sucht12
zu den11
die deinzer11
weiter 1209201711
das gebiet11
weiter 0709201711
ab sofort11
mit einer11
wolf ist11
wenn sie11
urban schlick11
ghoffmann urban11
zweigniederlassungen ghoffmann11
den zweigniederlassungen11
gmbh mit11
einem weiter10
personalberatung sucht10
sie mit10
weiter 2408201710
hier weiter10
sind sie10
das bad10
homeoffice als9
den fhrenden9
weiter 280820179
fachgrohandel fr9
mit uns9
weiter 220820179
bei dem9
wir ein9
sucht geschftsfhrer9
ist die9
wimtec ocean9
testo 330-29
suche weiter9
sucht vertriebsmitarbeiter9
mit ber9
ist unser9
als weiter9
sucht kundendiensttechniker9
von haustechnikpersonal9
das neue9
sucht planerberater8
weiter 020620178
brunata mnchen8
fr ihre8
auendienst fr8
wieder einmal8
sie als8
neue trikot8
mit einem8
uhr weiter8
330-2 lx8
verkaufsberater mw8
im weiter8
von weiter8
mittelstndisches unternehmen8
sucht gebietsverkaufsleiter8
partner von8
der fhrende8
als bewerber8
september 20178
saison weiter8
3092017 untersttzen8
18 30920178
schneider hat8
untersttzen sie8
mit format8
auendienst mw8
ihren lieblings-verein8
weiter 210820178
format ihren8
sich das8
vom 188
format wannen8
holen sie8
trikot der8
neue format8
den groraum8
wannen exklusive8
einem der8
handwerkeraktion vom8
der saison8
der haustechnik8
exklusive handwerkeraktion8
groraum frankfurt8
sie bitte7
auch sie7
2017 weiter7
gebudetechnik referenz-nr7
der heizungs-7
vor ber7
aus dem7
fr gebudetechnik7
die aufgabenstellung7
weiter 040920177
vertriebsmitarbeiter mw7
themen im7
seit ber7
gmbh ist7
mw die7
sucht verkaufsberater7
frling ist7
im handwerks-7
handwerks- energie-7
fr alle7
projektberater mw7
mw zurzeit7
110 jahren7
schell sucht7
weiter 300620177
gabag flexzarge7
flexzarge schnittschutz7
produktmanager mw7
weiter 030820177
brtje sucht7
fhrenden europischen7
bad direkt7
europischen hersteller7
nicht das7
spannendsten themen7
umweltfreundlicher weiter7
gebietsverkaufsleiter mw7
fr kesselheld7
hersteller innovativer7
arbeitest du7
der spannendsten7
uns arbeitest7
kesselheld gmbh7
gmbh vorstellung7
2017 17006
mitarbeitern weiter6
700 mitarbeitern6
1700 uhr6
sucht verstrkung6
herz commotherm6
bieten hat6
zu bieten6
hat hier6
weiter 240720176
unternehmen mit6
gmbh sucht6
imi hydronic6
eigentmergefhrtes mittelstndisches6
mehr als6
groraum stuttgart6
manager mw6
klimatechnik bei6
sauerland zu6
klimatechnik sucht6
mnchen ist6
weiter 080620176
frling sucht6
werden auch6
ein eigentmergefhrtes6
interessanter unternehmen6
hydronic engineering6
mit sitz6
fr innovative6
gebudetechnik der6
der als6
ein fachgrohandel6
am standort6
den bereich6
umsetzung der6
unsere produkte6
als starker6
watts industries6
unsere weiter6
standort worms6
mittelstands- allianz6
starker partner6
allianz haustechnik6
weiter 110820176
im groraum6
sind nicht6
natur sind6
unberhrte natur6
das einzige6
das sauerland6
mw projekte6
projekte fr6
wasser wlder6
eine weiter6
kunden von6
sucht produktmanager6
heizen mit6
fhrenden herstellern6
weiter 270720176
anbieter von6
bis zu6
von industrie6
fhrenden unternehmen6
gmbh angebotsaktion6
din 185346
bereich systemtechnikhaustechnik6
bereich der6
haustechnik sucht6
sucht mitarbeiter6
ess duschrinne6
dem weiter6
produkte fr6
sie ihre6
hersteller der6
profis fr5
premium weiter5
einer premium5
kontaktpotential mit5
stiebel eltron5
aco haustechnik5
herz wartet5
der weltweit5
unser auftraggeber5
auftraggeber ist5
enormen kontaktpotential5
diesem enormen5
xing berschritten5
netzwerk xing5
beruflichen netzwerk5
dem beruflichen5
berschritten kunden5
sanitr heizung5
von diesem5
profitieren von5
haustechnikpersonal profitieren5
wasser wrmepumpe5
von doyma5
przision qualitt5
funktionalitt unser5
mandant steht5
steht als5
design przision5
stuttgart homeoffice5
ist im5
commotherm luft5
direct search5
mw projektgeschft5
als weltweit5
weltweit erfolgreicher5
wasser sparen5
sucht projektberater5
sparen unser5
luft wasser5
bewegen strom5
viel bewegen5
zu finden5
erfolgreicher weiter5
homeoffice viel5
mrkte mit5
der mrkte5
einmal mit5
sind wir5
sie direkt5
mitte-west homeoffice5
als internationaler5
im innendienst5
wrmepumpe ab5
mandant als5
sanitrtechnik ist5
internationaler hersteller5
5990- herz5
universal prfbonus5
referenz-nr 10805
mw gebudetechnik5
dwmb sucht5
ab 5990-5
1080 baden-wrttemberg5
baden-wrttemberg mitte-west5
weyland bietet5
bietet stelle5
stelle als5
weiter 250720175
spezialist von5
10000 kontakten5
jubilums-set 15
von 100005
anzahl von5
produkte sind5
sind innovativ5
praxisfortschritt der5
kontakten bei5
den praxisfortschritt5
gestalten den5
magische anzahl5
die magische5
die speicherstein-anlage5
das sind5
die neue5
fhrende spezialist5
hat erstmalig5
weiter 050720175
besuchen sie5
aus der5
erstmalig die5
kommen sie5
homeoffice design5
gmbh fachhelfer5
rotex sucht5
ber 255
fachhelfer fr5
heizungsinstallation region5
weiter 310720175
weiter 230520175
webinar danfoss5
innovative produkte5
stckholzheizungen im5
hargassner ist5
innovative fachhandwerker5
weiter 090620175
ein sterreichischer5
sterreichischer hersteller5
hackgut- pellets-5
von hackgut-5
mnchen brunata5
aus weiter5
auf werden5
attacke innovative5
sie innovationsfhrer5
aktion auf5
besonderen aktion5
herz attacke5
einer ganz5
ganz besonderen5
innovationsfhrer weiter5
eines familienunternehmens5
fachhandwerker herz5
mw zur5
sucht technischen5
weiter 170820175
weiter 260420175
weiter 200420175
wartet wieder5
25 jahre5
fr heizungsinstallation5
lsungen fr5
familienunternehmen mit5
knnen sich5
kundendienstmonteur mw4
region stuttgart4
mw region4
zur entwicklung4
wir suchen4
account manager4
direkt bei4
zum thema4
den standort4
unternehmen bewerben4
dem unternehmen4
mitarbeiterin im4
pelletskessel mit4
zur qualittskontrolle4
des jeweiligen4
orts- weiter4
kundenberatung sowie4
sowie als4
der kundenberatung4
mehr weiter4
standort brensbach4
brensbach fhrungsaufgaben4
als shk-projektleiter4
shk-projektleiter mit4
jahre testo4
herz pelletskessel4
den orts-4
das den4
einem gehalt4
gehalt das4
fr unseren4
60 jahre4
um die4
im messgerteservice4
sucht kundendienstmonteur4
messgerteservice fhrten4
der karriereseite4
direkt mit4
ltw mnchen4
mnchen kg4
bewerber weiter4
familienunternehmens mit4
handelhandwerk fr4
mw handelhandwerk4
wir mit4
so sind4
haustechnikpersonal so4
vonnbsp haustechnikpersonal4
das ist4
einer von4
global player4
bewerben das4
shk standort4
als zuverlssiger4
von vielennbsp4
weiter 060720174
riho sucht4
karriereseite des4
fhrten zur4
mehrwerten vonnbsp4
vielennbsp mehrwerten4
nach din4
sucht mitarbeiterin4
oder technikerin4
von systemen4
verffentlicht die4
haustechnikpersonal verffentlicht4
die hygienische4
hygienische weiter4
logos interessanter4
die logos4
fhrenden anbieter4
weltweit fhrenden4
fr abgasmessgerte4
uponor ist4
digital vernetzten4
mit digital4
ber 7004
sich bei4
bei interesse4
qio untersttzt4
ber 604
weiter 010820174
jahre erfahrungen4
bewerber darauf4
klicken sind4
darauf klicken4
unternehmen wenn4
interesse direkt4
neuen servicekonzeptes4
eines neuen4
auch weiter4
zur innenraumabdichtung4
servicekonzeptes weiter4
mw baden-wrttemberg4
frankfurt uponor4
oder frankfurt4
worms die4
entwicklung eines4
der rauchmelder-montagen4
unternehmens verbunden4
bad weiter4
zu weiter4
bietet der4
qualittskontrolle der4
fr germann4
anlagenmechaniker-meisterin oder4
kuhfuss delabie4
gmbh anlagenmechaniker-meisterin4
jeweiligen unternehmens4
aussendienst fr4
germann gmbh4
vorstellung 24h-messgerteservice4
24h-messgerteservice fr4
vernetzten mobilen4
mobilen heizzentralen4
wm trinkwassersysteme4
trinkwassersysteme standorte4
hafurt oder4
standorte hafurt4
produktmanager wm4
gmbh produktmanager4
im bad4
mw wasser4
erfahrungen im4
ocean e104
uponor gmbh4
fr uponor4
technikerin shk4
ber 804
vasco sucht4
den neuen4
dem zufall4
nichts dem4
planerberater wrmeverteilung4
lftung fr4
fachplaner tga4
zielgruppen architekten4
die zielgruppen4
jahren verbindet4
berlasse nichts4
doyma startet4
ber 1104
kg sucht4
rohrleitungssysteme metall4
mw rohrleitungssysteme4
weiter 130620174
weiter 140620174
weiter 160620174
brunata sucht4
ocean p114
verbindet viega4
aufgabenstellung sie4
damit weiter4
erhht damit4
sofort direct4
die gabag4
weiter die4
die erfolgschancen4
passende bewerber4
preisgnstig passende4
erfolgschancen preisgnstig4
leistet ab4
haustechnikpersonal leistet4
kundenstamm durch4
den kundenstamm4
bauen den4
sie bauen4
durch intensive4
intensive betreuung4
ihres weiter4
innerhalb ihres4
betreuung innerhalb4
mobile heizzentralen4
hargassner sucht4
haben mchten4
mchten klicken4
klicken sie4
bitte mehr4
meldung haben4
dieser meldung4
weitere detailinfos4
detailinfos zu4
zu dieser4
mehr sie4
sie verlassen4
mandanten bei4
wird die4
vertrauen sie4
get nord4
verstrkung kundendiensttechniker4
das weiter4
haustechnik auf4
verlassen weiter4
hydraulischer abgleich4
sie weitere4
die camina4
weiter 020820174
aquis sanitr4
sanitr ag4
oktober 20174
neuen standort4
das vertriebsgebiet4
sucht service-techniker4
service-techniker biomasseheizungen4
mw hargassner4
duschrinne neu4
sanitr mw4
berzeugt mit4
unternehmen im4
seit mehr4
die perfekte4
gersthofen technisches4
sanitr- heizungs-4
gebietsleiter sanitr4
weiter 190520174
weiter 090820174
bewerber fr4
unternehmen unser4
markenservice direkt4
direkt ab4
nord-hessen technisches4
ab werk4
fr deutschland4
der neuen4
seit der4
fachberater mw4
sucht fachberater4
judo sucht4
werk weiter4
sucht vertriebsprofi4
60 jahren4
oventrop sucht4
sie uns4
ihre monteure4
lx jubilums-set4
ihre vakanzen4
sucht einen4
deutschland planung4
ve 2004
der grndung4
grndung vor4
mw fachbereich4
heiztechnik fr4
drger x-am4
steht fr4
mobile wrme4
ein weiter4
soliditt eines4
geschftsfhrer installations-4
unternehmen wir4
wasseraufbereitung weiter4
der wasseraufbereitung4
judo der4
ist judo4
jahren ist4
80 jahren4
der vorreiter4
vorreiter auf4
gebiet der4
dem gebiet4
auf dem4
fr baden-wrttemberg4
whler ve4
schnittschutz ist4
werden bder4
bder aus4
aus einheitlicher4
einheitlicher weiter4
fr eine4
kaldewei werden4
der entwicklungsstrategie4
duschflchen badewannen4
oder waschtische4
waschtische mit4
mit kaldewei4
weiter 100820174
viega die4
werden durch4
durch das4
sofort werden4
finden ab4
vakanzen zu4
das team4
team von4
3 personentage4
das direkte4
zu 34
haustechnikpersonal bis4
ihrem unternehmen4
ob duschflchen4
badewannen oder4
seit 19894
oventrop ist4
weiter 290620174
haustechnik mit4
die haustechnik4
personalberatung seit4
von armaturen4
systemen fr4
heizung klima4
zusammenarbeit mit4
der muttergesellschaft4
muttergesellschaft fr4
die sicherheit4
kaldewei sucht4
servicetechniker mw3
hppe sucht3
produkttechniker mw3
standort attendorn3
weiter 040820173
sucht produkttechniker3
attendorn seit3
ber das3
auch fr3
als fhrender3
die hppe3
ein unternehmen3
brtje gmbh3
die august3
technischen auendienst3
der international3
thermea-gruppe mit3
bdr thermea-gruppe3
aufgestellten bdr3
international aufgestellten3
august brtje3
weiter 190720173
weiter 200620173
industries europe3
ber weiter3
hydronische weiter3
fr hydronische3
europe bv3
seit jahrzehnten3
stuttgart referenz-nr3
referenz-nr 10713
direkt weiter3
junior verkaufsberater3
sucht junior3
spezialist fr3
globale anbieter3
service techniker3
techniker norddeutschland3
sucht service3
engineering sucht3
ihre weiter3
norddeutschland mw3
mw referenznummer3
fhrende globale3
engineering ist3
062017 imi3
referenznummer 0620173
1071 groraum3
bei das3
fr thermondo3
gebietsleiter auendienstmitarbeiter3
hsk prsentiert3
prsentiert zahlreiche3
zahlreiche neuheiten3
weiter 100520173
weiter 040520173
weiter 240420173
suchen wir3
weiter 250420173
weiter 270420173
weiter 280420173
neu-ulm aktuelle3
aktuelle trends3
kofen sucht3
kofen gehrt3
heiztechnik sucht3
trends bei3
weiter 070620173
europa zu3
herstellern innovativer3
weiter 180520173
heizungs- klima-3
weiter 260520173
komfortabler weiter3
nutzen sie3
mit nutzen3
pluggit entwickelt3
entwickelt produziert3
pluggit sucht3
weiter 280720173
hannover aktuell3
vertreibt innovative3
innovative lftungssysteme3
eines der3
dezember 20173
wrmerckgewinnung fr3
mit wrmerckgewinnung3
lftungssysteme mit3
fr hannover3
sie auch3
herstellern der3
der sanitrindustrie3
europaweit zu3
gehrt europaweit3
gmbh gehrt3
sanitrindustrie wir3
wir punkten3
wachsen sie3
wollen wachsen3
wir wollen3
punkten mit3
sie suchen3
shk-betriebe mit3
wir verstehen3
verstehen es3
jahren wir3
als 1103
viega seit3
es unsere3
ratiopharm arena3
fr profis3
weiter 280620173
vertriebsmitarbeiter im3
der ratiopharm3
bei viega3
wir bei3
von sanitrtechnik3
sucht vertriebsbeauftragter3
betreuung unserer3
abgas-analysegert testo3
untersttzt shk-betriebe3
weiter 210720173
weiter 200720173
innovativ das3
angebotsaktion 603
repabad sucht3
systemtechnikhaustechnik sucht3
hppe gmbh3
der vom3
haustechniknachfolge bietet3
raum fr3
bietet den3
hamburg aktuell3
den gesamtservice3
fr hamburg3
haustechnik rckstau-systeme3
rckstau-systeme schtzen3
innerhalb eines3
eines kurzen3
treten innerhalb3
hochwasser-schden treten3
schtzen vor3
vor hochwasser-schden3
gesamtservice fr3
die nachfolgeregelung3
co kg3
kundendienst-techniker mw3
miete die3
zur miete3
wir machen3
heizzentralen zur3
konzept zur3
bereit fr3
die verkaufsregion3
tga die3
unser bewhrtes3
mit hchstem3
bewhrtes konzept3
die wimtec3
kurzen zeitraumes3
zeitraumes groe3
ist das3
finden sie3
die zeit3
drngt die3
fr mobile3
einmal drngt3
vertriebsprofi heizungstechnikmw3
heizungstechnikmw aus3
angebotsaktion drger3
mit universal3
jetzt auch3
austria email3
dem raum3
mit sonnenkraft3
sie sonnenkraft3
sonnenkraft auf3
auf kann3
kann es3
niederschlag auf3
von niederschlag3
groe mengen3
mengen von3
es durch3
durch eine3
mitarbeiter mw3
mw als3
um weiter3
conti sanitrarmaturen3
sanitrarmaturen gmbh3
einer weiter3
der region3
region kln3
kln aachen3
nrw region3
1077 nrw3
gebudesystemtechnik referenz-nr3
referenz-nr 10773
aachen niederrhein3
niederrhein homeoffice3
dicht mit3
badbereich dicht3
mit 103
wirtschaftlichkeit umweltschutz3
homeoffice energieeffizienz3
energieeffizienz wirtschaftlichkeit3
mw gebudesystemtechnik3
im angebot3
area sales3
sales manager3
sucht area3
global water3
dem m3bbadplaner3
water solutions3
nicht nur3
camina ein3
jahren garantie3
10 jahren3
garantie weiter3
punktesystem fr3
mitarbeiter sind3
mw mitte3
mitte zurzeit3
aufgabenstellung umfasst3
umfasst die3
nachfolgeregelung 13
bremen die3
rltanlagenbau klima-luftung3
klima-luftung mw3
die verantwortliche3
verantwortliche durchfhrung3
zur nachfolgeregelung3
die zukunft3
im auftrag3
projekten mit3
steuerung von3
von projekten3
projektleiter rltanlagenbau3
sohn projektleiter3
dicht nach3
alles dicht3
nach norm3
norm din3
komplettset badbereich3
18534 komplettset3
neu alles3
mandant mit3
fr peinemann3
peinemann sohn3
1 umfangreiche3
umfangreiche betriebsanalyse3
vorbereitung weiter3
aeg zu3
zu einer3
1989 zwei3
zwei strategien3
sanitrbranche sucht3
die shk-branche3
mitsubishi electric3
bei weiter3
strategien ein3
ein ziel3
teamleiter mw3
region frankfurt3
doyma weiter3
weiter 140820173
ziel mehr3
60 weiter3
angebot fr3
die unternehmensberatung3
verkufer angedachten3
angedachten zeit3
vom verkufer3
viele nachfolgeregelungen3
leider scheitern3
scheitern viele3
zeit weil3
weil er3
hat ihre3
unternehmensberatung ewald3
ihre dienstleistung3
dienstleistung nachfolgeregelung3
er viele3
viele weiter3
dichtungseinstze von3
geschftsfhrer maschinenbau3
schutz gegen3
effektiver schutz3
ludwigsfelde die3
gegen radon3
jahren gegrndete3
gegrndete weiter3
doyma effektiver3
camina speicherstein-anlage3
sd zurzeit3
weiter 080820173
nordrhein-westfalen sd3
mw nordrhein-westfalen3
systemtechnikhaustechnik bei3
planerberater mw3
das vor3
begriff das3
100 gewerblichen3
der lohnfertigung3
ber 1003
frankfurt familienunternehmen3
maschinenbau im3
radon dichtungseinstze3
lohnfertigung ews3
ews 13013
ein fester3
fester begriff3
frankfurt ein3
mandant ist3
1301 unser3
unternehmensnachfolge leider3
schneider unternehmensnachfolge3
fr ein3
alle die3
gemeinsam mit3
sie ein3
clage sucht3
innendienst fr3
gesucht wir3
herbst 20173
sd-ost zurzeit3
baden-wrttemberg sd-ost3
speziell fr3
sucht techniker3
vertriebsmitarbeiter-in aussendienst3
sucht vertriebsmitarbeiter-in3
haustechnik gehren3
bietet hier3
von hsk3
hufig treten3
gehren wir3
der marke3
marke aeg3
bafa bund3
treten gesundheitsgefhrdende3
gesundheitsgefhrdende gase3
auf drger3
drger bietet3
sauerstoffmangel auf3
sowie sauerstoffmangel3
dmpfe sowie3
30082017 neue3
erstes ehh3
mah ist3
ist eine3
kurz mah3
haustechnik kurz3
klima die3
die mittelstands-3
eine einkaufs-3
marketingverbundgruppe weiter3
zuverlssige industrie-handelsvertretung3
region bremen3
das verkaufsgebiet3
key account3
ab lager3
ist online3
mw sanitr3
grohandelskaufmann mw3
die sonne3
sonne schickt3
energiewende die3
thema energiewende3
ehh heizungs-symposium3
heizungs-symposium zum3
schickt uns3
uns bekanntlich3
mah mittelstands-3
sucht grohandelskaufmann3
rechnung weiter3
keine rechnung3
bekanntlich keine3
weiter 070820173
weiter706
der372
fr366
die292
sucht281
mw237
mit235
im163
von144
das138
sie134
ist133
wir103
den99
ein97
bei83
gmbh82
unternehmen82
als75
hersteller69
zu68
auf60
sind58
dem56
haustechnikpersonal52
untersttzen49
bereich48
neue47
fhrenden44
042
ber42
einem41
141
einer41
region39
zur39
fhrendes39
0609201738
auch38
gebietsleiter38
uns38
shk-branche37
eine36
groraum36
0809201735
einen35
nach35
235
oder34
unser33
zum33
0109201733
standort33
332
w32
schneider31
ewald31
haustechnik31
431
sich31
530
deinzer30
weyland30
haben29
ab28
aus28
mnchen28
am27
mehr27
werden27
bietet26
626
unserer26
personal26
ihre25
seit25
zurzeit25
unseren25
hat24
homeoffice24
referenz-nr24
zahlreiche24
auendienst23
ww23
windhager22
suche22
direkt22
des21
viega21
herz21
sanitr21
bad21
kunden21
kleinschmidt20
frankfurt20
eines20
mitarbeiter20
stuttgart19
jahren19
mitarbeiterinnen19
auendienstmitarbeiter19
fhrender19
wasser19
motivation19
know-how19
innovationen19
neuen19
technisches19
es19
baden-wrttemberg18
vom18
mandanten18
unsere17
produkte17
gebiet17
gebudetechnik17
bis17
717
vor17
innovative17
drger17
mandant17
format16
testo16
816
durch16
design16
brtje16
aktuell16
personalberatung16
doyma16
wenn16
september15
heizungs-15
nicht15
sowie15
ihren15
noch14
jahre14
deutschland14
klimatechnik14
wimtec14
914
qio14
kundendiensttechniker14
raum14
berlin14
wolf14
weltweit14
1013
du13
camina13
frling13
steht13
um13
0509201713
jetzt13
hamburg13
gabag13
1113
bewerber13
repabad12
brunata12
1212
ihr12
vertriebsmitarbeiter12
viele12
heizung12
luft-12
1312
neu11
0709201711
verkaufsberater11
keuco11
mitarbeitern11
produktmanager11
hannover11
viel11
watts11
nachfolgeregelung11
suchen11
ghoffmann11
wird11
schlick11
urban11
1411
wieder11
zweigniederlassungen11
bremen11
oventrop11
kaldewei11
ecom11
din11
sofort11
energie-10
bieten10
manager10
uhr10
wrme10
heizen10
seinen10
innovativer10
shk10
hargassner10
mobile10
gehrt10
zwei10
ohne10
hier10
innovativ10
whler10
dwmb10
anbieter10
1510
riho10
nur10
speicherstein-anlage10
ganz10
neu-ulm10
kg10
industrie10
systemen10
unter9
sparen9
qualitt9
global9
sitz9
169
179
ocean9
diesem9
webinar9
mittelstndisches9
kofen9
vertrieb9
finden9
fachgrohandel9
330-29
heizzentralen9
innendienst9
uponor9
189
wie9
ess9
fhrende9
einmal9
geschftsfhrer9
schell9
heiztechnik9
conti9
spezialist9
gestalten8
judo8
august8
so8
partner8
bayern8
zeit8
lsungen8
techniker8
danfoss8
neuer8
sanitrtechnik8
198
kann8
erfolgreicher8
klicken8
geht8
betreuung8
worms8
rotex8
mchten8
aufgabenstellung8
profis8
208
lieblings-verein8
lsung8
produziert8
handwerkeraktion8
zukunft8
vorstellung8
exklusive8
holen8
alle8
saison8
hsk8
familienunternehmen8
planerberater8
strom8
sonnenkraft8
perfekte8
trikot8
wannen8
alles8
020620178
gebietsverkaufsleiter8
entwicklung8
lx8
umweltfreundlicher7
stelle7
einfach7
fachhandwerker7
nrw7
untersttzt7
flexzarge7
natur7
planung7
schnittschutz7
innerhalb7
bitte7
abgleich7
europischen7
hppe7
217
richterfrenzel7
damit7
armaturen7
starker7
entwickelt7
040920177
kesselheld7
projektberater7
spannendsten7
030820177
shk-tv7
dieser7
gesucht7
sales7
sd7
themen7
badewannen7
kermi7
227
handwerks-7
kln7
arbeitest7
aber7
aco7
technischen7
bder7
projekte7
beim7
ob7
airclean7
wrmepumpe7
237
duschflchen6
interessanter6
eigentmergefhrtes6
sanitr-6
systemtechnikhaustechnik6
termin6
246
haustechniknachfolge6
ihrer6
mefa6
aktion6
iwo6
profitieren6
man6
wm6
treten6
industries6
engineering6
hygienische6
vier6
256
angebotsaktion6
bemm6
waschtische6
europa6
080620176
pellets-6
auftraggeber6
teil6
jeder6
hydronic6
dallmer6
kommen6
neues6
amp6
allianz6
projektgeschft6
vertriebsgebiet6
wollen6
trinkwasserhygiene6
knnen6
mittelstands-6
mah6
imi6
macht6
leistet6
schon6
zielgruppen6
verstrkung6
nord6
verffentlicht6
water6
266
unternehmens6
einzige6
unberhrte6
wlder6
276
sauerland6
besuchen6
m3bbadplaner6
dicht6
technische6
286
angebot6
award6
aeg6
bereits6
international6
technischer6
geberit6
herstellern6
schnell6
digital6
pluggit6
sicherheit6
wachsen6
commotherm6
296
besonderen6
306
umsetzung6
duschrinne6
energie5
bauen5
ihnen5
ihres5
vertriebsprofi5
keine5
teamleiter5
315
search5
direct5
stiebel5
wdv-mollin5
querschiesser5
ziel5
intelligent5
romay5
przision5
startet5
kontaktpotential5
jahr5
sonne5
325
brandschutz5
verkaufsregion5
lftung5
335
345
erstmalig5
umsatz5
xing5
netzwerk5
355
abgasmessgerte5
mitte-west5
berschritten5
zuverlssiger5
biomasseheizungen5
premium5
enormen5
klima5
handwerker5
internationaler5
090620175
anzahl5
planer5
magische5
eltron5
mitarbeiterin5
heizungsinstallation5
klima-5
365
smart5
beruflichen5
groe5
jubilums-set5
kontakten5
passende5
schritt5
prfbonus5
praxisfortschritt5
ag5
aussendienst5
oktober5
bundesweit5
erstes5
ihrem5
stckholzheizungen5
projektleiter5
universal5
verbunden5
thema5
050720175
attacke5
luft5
5990-5
fachhelfer5
375
familienunternehmens5
kundendienstmonteur5
vertrauen5
wartet5
berzeugt5
punktesystem5
mrkte5
dsseldorf5
innovationsfhrer5
bewegen5
hufig5
sterreichischer5
installations-5
machen5
funktionalitt5
clage5
architekten5
beratung5
hackgut-5
385
wurde5
395
attraktive5
deutsche5
serie4
herbst4
gehalt4
shk-projektleiter4
schweiz4
kundenberatung4
plz4
fortech4
detailinfos4
metall4
get4
ecke4
aquis4
rohrleitungssysteme4
soliditt4
orts-4
delabie4
020820174
gemeinsam4
kuhfuss4
leipzig4
010820174
service4
magus4
verlassen4
account4
verkaufsgebiet4
mehrwerten4
zuverlssige4
vielennbsp4
thringen4
404
entwicklungsstrategie4
weitere4
414
424
online4
vonnbsp4
434
bewerben4
shk-handwerk4
darauf4
logos4
rauchmelder-montagen4
er4
qualittskontrolle4
verbindet4
werk4
jeweiligen4
interesse4
karriereseite4
ltw4
handelhandwerk4
gebude-4
vision4
zusammenarbeit4
fhrungsaufgaben4
meldung4
schornsteintechnik4
444
454
brensbach4
hafurt4
standorte4
service-techniker4
pures4
thermondo4
platz4
trinkwassersysteme4
vertreibt4
464
technikerin4
markenservice4
sanibad4
einheitlicher4
innenraumabdichtung4
muttergesellschaft4
0720174
player4
474
anlagenmechaniker-meisterin4
bette4
090820174
germann4
060720174
regionen4
e104
nichts4
anlagenmechaniker4
conel4
panasonic4
bafa4
umfasst4
energiewende4
steuerung4
wirtschaftlichkeit4
gebudesystemtechnik4
badmbel4
vielen4
wer4
badplanung4
afriso4
weil4
hydraulischer4
co4
attraktiven4
erfolgschancen4
erhht4
intensive4
preisgnstig4
vakanzen4
484
team4
kundenstamm4
tga4
berlasse4
p114
zufall4
vasco4
fachplaner4
wrmeverteilung4
494
mittwoch4
gesamtkonzept4
system4
gersthofen4
dass4
gegen4
extrem4
stellt4
erhalten4
zipless4
prsentiert4
504
kommt4
vernetzten4
mobilen4
514
powermesse4
pelletskessel4
brennwerttechnik4
grohandel4
servicekonzeptes4
fhrten4
setzen4
gehren4
flexibel4
marke4
messgerteservice4
erfahrungen4
building4
pumpen4
innovativen4
erweitert4
24h-messgerteservice4
kompletten4
personentage4
solutions4
vorreiter4
aktuellen4
kurz4
524
534
wasseraufbereitung4
544
ve4
immer4
nord-hessen4
video4
saarland4
weg4
nordrhein-westfalen4
fachbereich4
monteure4
fachberater4
direkte4
grndung4
x-am4
liegt4
gut4
leicht3
electric3
braucht3
stundenverrechnungssatz3
dmpfe3
elektronische3
mitsubishi3
endlich3
sauerstoffmangel3
vertriebsbeauftragter3
sdost3
553
rosenheim3
dichtungseinstze3
verstehen3
familir3
563
firma3
gesundheitsgefhrdende3
erste3
schweinfurt3
flach3
573
seine3
gase3
wrmerckgewinnung3
zeigen3
vertriebsmitarbeiter-in3
neuss3
produkttechniker3
wilhelm3
attendorn3
haus3
thermea-gruppe3
bdr3
offenburg3
karlsruhe3
040820173
beliebte3
lange3
aufgestellten3
heizungstechnikmw3
vertriebsleiter3
speziell3
dienstleistung3
ultra3
energien3
lftungssysteme3
radon3
workshops3
unternehmensberatung3
583
sondern3
sinusverteiler3
servicetechniker3
sd-ost3
europaweit3
unseres3
punkten3
sanitrindustrie3
lftungstechnik3
vereint3
prozessanlagen3
flssigkeitskonditionierung3
aktuelle3
593
neuheiten3
oem3
liefert3
trends3
frderung3
arena3
abgas-analysegert3
technologiefhrender3
ratiopharm3
603
komfortabler3
fachhandwerk3
613
623
633
643
destatis3
hosanit3
var3
sachsen3
653
663
gerte3
videoprsentation3
rund3
energy3
quelle3
040520173
regensburg3
betrieb3
referenznummer3
norddeutschland3
nutzen3
0620173
globale3
673
hydronische3
683
home3
schimmelbildung3
effektiver3
werkzeug3
jeden3
internationale3
grte3
europe3
bv3
693
royal3
bund3
shk-betriebe3
augsburg3
070620173
spiegelschrank3
703
sachbearbeiter3
wichtige3
dezember3
pcs3
junior3
jahrzehnten3
schutz3
effizienz3
rheinland3
miete3
wassertechnik3
pfalz3
industrie-handelsvertretung3
auftrag3
effiziente3
ifo3
bleiben3
aquatherm3
produkt3
bereit3
sterreich3
kundendienst-techniker3
wirtschaftlich3
key3
leben3
zehnder3
simplex3
deutschen3
peinemann3
hundert3
findet3
leider3
unternehmensnachfolge3
sohn3
rltanlagenbau3
durchfhrung3
dynamic3
projekten3
verantwortliche3
ins3
klima-luftung3
dienstag3
klimaziele3
ansprche3
niederschlag3
mengen3
zeitraumes3
komfort3
wartung3
einfache3
inda3
kurzen3
deutschlands3
schtzen3
rckstau-systeme3
elements3
freistehende3
lieferbar3
hochwasser-schden3
eco3
wirtschaft3
erhltlich3
einkaufs-3
grohandelskaufmann3
bedienkomfort3
marketingverbundgruppe3
hchstem3
sorgt3
lager3
technik3
montage3
ehh3
s43
heizungs-symposium3
schickt3
rechnung3
bekanntlich3
scheitern3
nachfolgeregelungen3
versorgungstechnik3
sanitrarmaturen3
kennen3
ingenieur3
713
email3
syr3
muss3
723
umfangreiche3
betriebsanalyse3
vorbereitung3
konzept3
bewhrtes3
abdichtung3
gesamtservice3
austria3
ersten3
planen3
ludwigsfelde3
grundfos3
drei3
programm3
080820173
messgert3
gegrndete3
begriff3
gewerblichen3
maschinenbau3
lohnfertigung3
ews3
fester3
733
norm3
komplettset3
duschen3
effizient3
pro3
umweltschutz3
khlen3
niederrhein3
energieeffizienz3
sommer3
743
deutscher3
angedachten3
verkufer3
drngt3
wilo3
nrnberg3
mitte3
aachen3
753
strategien3
sanitrbranche3
schnelle3
ausdehnungsgefe3
modernen3
badbereich3
garantie3
3d3
kampagne3
sprechen3
wrmepumpen3
etablierte3
kessel3
area3
moderne3
070820173

What are the nameservers for shk-journal.de?

Shk-journal.de Domain Nameserver Information

HostIP AddressCountry
ns37.1und1.de 217.160.80.151Germany Germany
ns38.1und1.de 217.160.81.151Germany Germany

Shk-journal.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Shk-journal.de is a scam?