Shopping.net - Comparison Online Shopping. Best prices for all the top brands and products.

Safety: Low trust score
Year Founded: 1997
Global Traffic Rank: 35,536
Estimated Worth: $925,200
Category: Shopping



Domain summary

Last updated
2021-01-10
Domain label
shopping
Domain extension
net
Domain registered:
1997-05-20
Domain updated:
2019-04-19
Global Traffic Rank
35,536
Statvoo Rating
D
Trust Score
Low Trust Score
Estimated worth
$925,200
Estimated daily income
$1,285
Estimated monthly income
$39,085

Rank summary

How is shopping.net ranked relative to other sites:

Percentage of visits to shopping.net from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Shopping.net registered?
A: Shopping.net was registered 23 years, 10 months, 4 weeks, 11 hours, 25 minutes, 47 seconds ago on Tuesday, May 20, 1997.
Q: When was the WHOIS for Shopping.net last updated?
A: The WHOIS entry was last updated 1 year, 11 months, 4 weeks, 11 hours, 25 minutes, 47 seconds ago on Friday, April 19, 2019.
Q: What are Shopping.net's nameservers?
A: DNS for Shopping.net is provided by the following nameservers:
  • dns1.p02.nsone.net
  • dns2.p02.nsone.net
  • dns3.p02.nsone.net
  • dns4.p02.nsone.net
Q: Who is the registrar for the Shopping.net domain?
A: The domain has been registered at MARKMONITOR INC..
Q: What is the traffic rank for Shopping.net?
A: Shopping.net ranks 35,536 globally on Alexa. Shopping.net has a Low Trust Score, and a Statvoo Rank of D.
Q: How many people visit Shopping.net each day?
A: Shopping.net receives approximately 107,082 visitors and 642,492 page impressions per day.
Q: What IP address does Shopping.net resolve to?
A: Shopping.net resolves to the IPv4 address 151.101.62.114.
Q: In what country are Shopping.net servers located in?
A: Shopping.net has servers located in the United Kingdom.
Q: What webserver software does Shopping.net use?
A: Shopping.net is powered by Nginx webserver.
Q: Who hosts Shopping.net?
A: Shopping.net is hosted by Consortium GARR in England, London, United Kingdom, Ec2v.
Q: How much is Shopping.net worth?
A: Shopping.net has an estimated worth of $925,200. An average daily income of approximately $1,285, which is roughly $39,085 per month.

Shopping.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Shopping.net Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Shopping.net

H1 Headings

1 :
  1. Shopping.net searches all the top stores, so that you don't have to.

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

1 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Shopping.net

partialshopnetheaderformdesturldepartmentshomeclick assettypeappeventspush partialtargetdataunifiedassettype primarytextlink varyoucsaprovidersourcedynamicloggingtimeoutfunction ehttpsgslclick assettype assettypeassettype assettypeapppayload actiontype0askunifiedpayloadexternaldatafunction successtimefromserpstartresponseclick handler functione var targettype click handlerbotcountpartialshopnethomepartialshopnetheaderbody elementselectorfunction e varassettype textunifiedapilogeventactiontargetaskmidcountpartialshopnetheader contextselector partialshopnetheaderbodypartialshopnetheader contextselectorfalseactiontype click assettypeaskunifiedaddpresentationcsazonepartialshopnethomebody elementselectorvar askpartial partialshopnetheader contextselectortopcountsubmite varundefined askunifiedappeventspush1unifiedapilogeventaction payloadtypeof askapppayloadedocumentask windowaskaskunifiedpayloadexternaldatanavinfouniqueresultsdisplayedifapp function appeventsclickpartial partialshopnethomepartialcontextselector partialshopnethomebody elementselectorclick handlerpollingproviderpayloadreturnresulttypeaskcsaresponsetimevar ask windowaskpayloadassettype targetdataunifiedassettypeask undefinedpartialshopnetheadercontextselector partialshopnetheaderbodycontextselectorappevents appeventspushaskunifiedpendingparamsassettypeaskcsashowserpstarttimeelementselectorprovidersappevents appeventsappevents appeventspush partialifextendpayloadfunction appeventsnavinfoeventvar assettype targetdataunifiedassettypepartialshopnethome contextselector partialshopnethomebodyaskunifiedpayload pageresultsaskunifiedaddprovidergslcontextselector document elementselectoraskunifiedpagecontextreadypartialshopnethomeformkeyregistersendbackfillonpageloadcompletetypeaskunifiedpayload pageresults providersaskunifiedpayloadresulttype gsl providersourcevar payloadvar assettypeundefined askunified askunifiedsendactionapppayloadifapp functionwindowasktmpval2varelse ifcatch eactiontypektargetdataunifiedassettype primarytextlinkdynamicbingjsloggingtimeouttextnullappeventscontextselector documentpartial partialshopnethome contextselectoraskunifiedpayloadprovidersprovidernameapppayload actiontype clickaskunifiedsendactionapppayloadvar apppayloadtimedouttypeof ask undefinedaskunifiedsendbackfillfunction varfunction appevents appeventsresulttype gsldocument elementselectorif typeofaskunifiedapihandlerextendapppayloadhandler functionpageresults providersaskunified askunifiedsendactionapppayloadif typeof askaskunifiedpendingproviderscontextselector partialshopnethomebodygsl providersource csaprovidersourcepartialshopnethome contextselectorundefinedpayload askunifiedapihandlerelseprimarytextlinktypeoffunctiontotaladspageresultsvar targetpartial partialshopnetheadercatchcbvar apppayload actiontypehandler function eextendpayload askunifiedpagecontextpayloadanuaappask undefined askunifiedunifieddatametainfoassettype targetdataunifiedassettype primarytextlinkhandlerprimarytextlink varprimarytextlink var apppayloadtrytargetdataunifiedassettyperesulttemplatesuccesstargetdataunifiedcallbackextendapppayload targetdataunifiedgsl providersourceifappactiontype clickpartialshopnethomebodytype clickeventelementselectorcontextselector partialshopnetheaderbody elementselectoraskunifiedappevents appevents appeventspushdepartmentsheadprovidersource csaprovidersourcepartialshopnetheaderbodyassettype assettype textprovidersourcetrue

Longtail Keyword Density for Shopping.net

KeywordsOccurences
var apppayload actiontype7
handler function e7
assettype assettype text7
function e var6
primarytextlink var apppayload6
actiontype click assettype5
click assettype assettype5
apppayload actiontype click5
var assettype targetdataunified-assettype5
ifapp function appevents4
e var target4
contextselector partialshopnethome-body elementselector4
partialshopnethome contextselector partialshopnethome-body4
partial partialshopnethome contextselector4
targetdataunified-assettype primarytextlink var4
assettype targetdataunified-assettype primarytextlink4
type click handler4
function appevents appevents4
appevents appeventspush partial4
appevents appevents appeventspush4
click handler function3
undefined askunified askunifiedsendactionapppayload3
ask undefined askunified3
typeof ask undefined3
if typeof ask3
contextselector partialshopnetheader-body elementselector3
partialshopnetheader contextselector partialshopnetheader-body3
partial partialshopnetheader contextselector3
contextselector document elementselector3
var ask windowask3
askunifiedpayload pageresults providers3
resulttype gsl providersource3
gsl providersource csaprovidersource3
handler function9
var assettype8
primarytextlink var7
assettype text7
assettype assettype7
apppayload actiontype7
var apppayload7
function e7
if typeof6
e var6
actiontype click5
click assettype5
assettype targetdataunified-assettype5
var target5
appeventspush partial5
partial partialshopnethome4
partialshopnethome contextselector4
contextselector partialshopnethome-body4
partialshopnethome-body elementselector4
extendapppayload targetdataunified4
var payload4
unifiedapilogeventaction payload4
targetdataunified-assettype primarytextlink4
function appevents4
ifapp function4
click handler4
type click4
appevents appevents4
appevents appeventspush4
providersource csaprovidersource3
gsl providersource3
resulttype gsl3
catch e3
function var3
function success3
payload askunifiedapihandler3
extendpayload askunifiedpagecontext3
pageresults providers3
ask windowask3
askunifiedpayload pageresults3
var ask3
document elementselector3
contextselector document3
partial partialshopnetheader3
partialshopnetheader contextselector3
contextselector partialshopnetheader-body3
partialshopnetheader-body elementselector3
typeof ask3
ask undefined3
undefined askunified3
askunified askunifiedsendactionapppayload3
else if3
var65
function47
033
assettype25
if24
else16
handler11
type10
e10
partial10
contextselector10
elementselector10
click9
return9
appevents9
payload9
typeof9
totalads8
askunifiedsendbackfill8
ask8
true8
extendapppayload8
primarytextlink7
actiontype7
apppayload7
text7
null7
17
navinfo6
askunified6
askunifiedsendactionapppayload6
26
false6
cb6
resulttemplate6
providersource5
botcount5
resulttype5
uniqueresultsdisplayed5
midcount5
askunifiedapihandler5
callback5
windowask5
dynamicloggingtimeout5
targetdataunified5
appeventspush5
target5
targetdataunified-assettype5
desturl5
partialshopnethome-body5
ready4
timedout4
askcsaresponsetime4
response4
partialshopnetheader-body4
unifiedapilogeventaction4
topcount4
askunifiedpayload4
submit4
csaprovidersource4
askunifiedpagecontext4
dynamicbingjsloggingtimeout4
askunifiedaddprovidergsl4
ifapp4
partialshopnethome4
unifieddatametainfo4
askunifiedpayloadprovidersprovidername4
tmpval3
event3
polling3
askunifiedaddpresentationcsazone3
catch3
askcsashowserpstarttime3
gsl3
try3
k3
pageresults3
timefromserpstart3
https3
partialshopnetheader3
partialshopnetheader-form3
undefined3
departments-head3
you3
partialshopnethome-form3
departments-home3
document3
providers3
askunifiedpayloadexternaldata3
askunifiedpendingproviders3
askunifiedpendingparams3
key3
providerpayload3
extendpayload3
payloadanuaapp3
success3
askunifiedpayloadexternaldatanavinfo3
registersendbackfillonpageloadcomplete3
eventelementselector3

Who hosts Shopping.net?

Shopping.net Hosting Provider Information

Hosted IP Address:151.101.62.114
Hosted Hostname:151.101.62.114
Service Provider:Consortium GARR
Hosted Country:United KingdomGB
Location Latitude:51.5164
Location Longitude:-0.093
Webserver Software:nginx

Is "Consortium GARR" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
Consortium GARR
0.1218%

HTTP Header Analysis for Shopping.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Connection: keep-alive
Content-Type: text/html; charset=utf-8
Server: nginx
X-App-Environment: eks-use1
X-XSS-Protection: 1
X-Frame-Options: DENY
Content-Security-Policy: frame-ancestors 'none';
X-Robots-Tag: noindex, nofollow
Content-Encoding: gzip
Accept-Ranges: bytes
Date: Sun, 10 Jan 2021 02:31:51 GMT
Via: 1.1 varnish
X-Served-By: cache-lon4258-LON
X-Cache: MISS
X-Cache-Hits: 0
X-Timer: S1610245911.439756,VS0,VE339
Vary: Accept-Encoding
transfer-encoding: chunked

Shopping.net Domain Nameserver Information

HostIP AddressCountry
dns1.p02.nsone.net 198.51.44.2
dns2.p02.nsone.net 198.51.45.2
dns3.p02.nsone.net 198.51.44.66
dns4.p02.nsone.net 198.51.45.66


Need to find out who hosts Shopping.net?


Domain Registration (WhoIs) information for Shopping.net

 Domain Name: shopping.net
Registry Domain ID: 1603817_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.markmonitor.com
Registrar URL: http://www.markmonitor.com
Updated Date: 2019-04-19T02:09:59-0700
Creation Date: 1997-05-19T21:00:00-0700
Registrar Registration Expiration Date: 2021-05-20T00:00:00-0700
Registrar: MarkMonitor, Inc.
Registrar IANA ID: 292
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.2083895770
Domain Status: clientUpdateProhibited (https://www.icann.org/epp#clientUpdateProhibited)
Domain Status: clientTransferProhibited (https://www.icann.org/epp#clientTransferProhibited)
Domain Status: clientDeleteProhibited (https://www.icann.org/epp#clientDeleteProhibited)
Domain Status: serverUpdateProhibited (https://www.icann.org/epp#serverUpdateProhibited)
Domain Status: serverTransferProhibited (https://www.icann.org/epp#serverTransferProhibited)
Domain Status: serverDeleteProhibited (https://www.icann.org/epp#serverDeleteProhibited)
Registrant Organization: IAC Publishing, LLC
Registrant State/Province: CA
Registrant Country: US
Registrant Email: Select Request Email Form at https://domains.markmonitor.com/whois/shopping.net
Admin Organization: IAC Publishing, LLC
Admin State/Province: CA
Admin Country: US
Admin Email: Select Request Email Form at https://domains.markmonitor.com/whois/shopping.net
Tech Organization: IAC Publishing, LLC
Tech State/Province: CA
Tech Country: US
Tech Email: Select Request Email Form at https://domains.markmonitor.com/whois/shopping.net
Name Server: dns1.p02.nsone.net
Name Server: dns3.p02.nsone.net
Name Server: dns4.p02.nsone.net
Name Server: dns2.p02.nsone.net
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2021-01-09T18:31:52-0800

Websites with Similar Names

Shopp-fast.com
shopp-fast.com
Shopp-ing-life.net
????????????????? |
Shopp-nette.com
Create an Ecommerce Website and Sell Online! Ecommerce Software by Shopify
Shopp-onlie.online
403 Forbidden

Recently Updated Websites

Foxtrotphoto.com (1 second ago.)Audizentrum-bologna.it (1 second ago.)Phoenixum.com (1 second ago.)Hermeslandscape.com (3 seconds ago.)Seismic-isolation.com (3 seconds ago.)Suburbitrealty.us (4 seconds ago.)Ralf-jacobs-ac.de (4 seconds ago.)Tealicioustreats.com (5 seconds ago.)Adultcomicsbooks.com (5 seconds ago.)Galerikeles.com (5 seconds ago.)Airshack.info (5 seconds ago.)Audirepweb.fr (5 seconds ago.)Picturesofnorway.net (6 seconds ago.)Hardwoodfloorseattle.com (6 seconds ago.)Pindersprintemporium.net (6 seconds ago.)Checkyourflight.com (6 seconds ago.)Galmash.biz (6 seconds ago.)Thepiptraders.com (7 seconds ago.)Divingwithdoug.com (7 seconds ago.)Braxtontylowers.com (7 seconds ago.)Autobombo.com (7 seconds ago.)80088008.xyz (7 seconds ago.)Robbdavisdesignbuild.com (7 seconds ago.)Grainnet.com (7 seconds ago.)Graciouspig.com (8 seconds ago.)Ronel.net (8 seconds ago.)Ctmgiftware.org (8 seconds ago.)Stormguidance.us (8 seconds ago.)Goingwilde.com (9 seconds ago.)Mi-ws.com (9 seconds ago.)

Recently Searched Keywords

type listitem position (1 second ago.)mangum (1 second ago.)rua2 (3 seconds ago.)bundesliga 2 table 2021 (3 seconds ago.)丝袜制服 (3 seconds ago.)et-db (4 seconds ago.)buket ayaz (4 seconds ago.)青青河边草在线视频免费 (6 seconds ago.)cooling solutions (6 seconds ago.)dropdowncategories1266808962--rootdropdowncategories1266808962--root dropdown3259921719--dropdown dropdown1652208387--dropdowncontent (9 seconds ago.)choosing google (10 seconds ago.)working from home (11 seconds ago.)simple-social-icons-4 (12 seconds ago.)gestioacuten de riesgo (12 seconds ago.)автомобильные наборы [112] (13 seconds ago.)để phát triển hơn nữa nông nghiệp công nghệ cao (13 seconds ago.)admin august (14 seconds ago.)2ddgw (17 seconds ago.)majlis perbandaran sepang (17 seconds ago.)cart help (19 seconds ago.)scandinavian interior design (22 seconds ago.)kabu (24 seconds ago.)law agency (24 seconds ago.)netcone.com (25 seconds ago.)franc-liqueurs (26 seconds ago.)gave meaning (26 seconds ago.)elizabeth city (27 seconds ago.)qq西游积分抽奖 (28 seconds ago.)bottomcolor-stop50rgba0000color-stop99rgba000083color-stop100rgba000085 background-webkit-linear-gradienttoprgba0000 (28 seconds ago.)et dolore magnam (29 seconds ago.)