Shrm.org  |  SHRM Online - Society for Human Resource Management
Low trust score  | 



Shrm.org Website Information

Website Ranks & Scores for Shrm.org

Statvoo Rank Statvoo Rank:C
Alexa Rank Alexa Rank:21,214
Majestic Rank Majestic Rank:3,474
Domain Authority Domain Authority:87%
DMOZ DMOZ Listing:No

Whois information for shrm.org

Full Whois Lookup for Shrm.org Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Shrm.org. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: SHRM.ORG
Registry Domain ID: D308459-LROR
Registrar WHOIS Server:
Registrar URL: http://www.enom.com
Updated Date: 2017-04-11T07:53:04Z
Creation Date: 1995-05-09T04:00:00Z
Registry Expiry Date: 2018-05-10T04:00:00Z
Registrar Registration Expiration Date:
Registrar: eNom, Inc.
Registrar IANA ID: 48
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: C102667007-LROR
Registrant Name: Todd Oosterveen
Registrant Organization: Society for Human Resource Management
Registrant Street: 1800 Duke Street
Registrant City: Alexandria
Registrant State/Province: VA
Registrant Postal Code: 22314
Registrant Country: US
Registrant Phone: +1.7036267861
Registrant Phone Ext:
Registrant Fax: +1.7033484473
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C102667007-LROR
Admin Name: Todd Oosterveen
Admin Organization: Society for Human Resource Management
Admin Street: 1800 Duke Street
Admin City: Alexandria
Admin State/Province: VA
Admin Postal Code: 22314
Admin Country: US
Admin Phone: +1.7036267861
Admin Phone Ext:
Admin Fax: +1.7033484473
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C102667007-LROR
Tech Name: Todd Oosterveen
Tech Organization: Society for Human Resource Management
Tech Street: 1800 Duke Street
Tech City: Alexandria
Tech State/Province: VA
Tech Postal Code: 22314
Tech Country: US
Tech Phone: +1.7036267861
Tech Phone Ext:
Tech Fax: +1.7033484473
Tech Fax Ext:
Tech Email: Login to show email
Server: NS3.P02.DYNECT.NET
Name Server: NS1.P02.DYNECT.NET
Name Server: NS2.P02.DYNECT.NET
Name Server: NS4.P02.DYNECT.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-08-17T18:29:10Z

Who hosts Shrm.org?

Shrm.org is hosted by Society for Human Resource Management in Maryland, Oxon Hill, United States, 20745.
Shrm.org has an IP Address of 198.22.197.80 and a hostname of www.shrm.org.



Shrm.org Web Server Information

Hosted IP Address:198.22.197.80
Hosted Hostname:www.shrm.org
Service Provider:Society for Human Resource Management
Hosted Country:United StatesUS
Location Latitude:38.803
Location Longitude:-76.99
Webserver Software:Not Applicable

HTTP Header Analysis for Shrm.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: no-cache
Pragma: no-cache
Content-Type: text/html; charset=utf-8
Expires: -1
Server: Microsoft-IIS/7.5
SPRequestGuid: c3a7059b-0ccf-4cc5-81cb-f94232f89bb3
X-SharePointHealthScore: 0
X-AspNet-Version: 2.0.50727
X-Powered-By: ASP.NET
MicrosoftSharePointTeamServices: 14.0.0.7149
X-MS-InvokeApp: 1; RequireReadOnly
Access-Control-Allow-Origin: http://l.shrm.org
Date: Fri, 12 Jun 2015 11:36:46 GMT
Connection: close
Content-Length: 97164


Need to find out who hosts Shrm.org?

Shrm.org Free SEO Report

Website Inpage Analysis for Shrm.org

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Shrm.org

advocacyhr magazinesearchjobssetattributehref javascriptjob nearfunction ucchrjobshtmlresourceslessshrm chinagetli afilterfunctionpolicylivar searchterm documentgetelementbyidtextboxtagidafilterfunction returnmemberateamtrendsfunction openinnewwindowanchortagidctl00pageviewtrackerimgtempattrsrc srcmhref httphrjobsshrmorgjobssearchresultsradius0location searchtermvalueshrmjobfinderucchrjobshtmladdclassshrmminijobfinder ucchrjobsplaceholderreplacewithjoin0 searchjobssetattributetarget blankindia0 ucchrjobsplaceholderlengtheventbuilderheightstrategyidshrmsvar hrefjavascript searchjobssetattributetargetucchrjobshtmltalentemployerjavascript searchjobssetattributetarget ifshrm indiaall eventsjob finder findnavnavbar lisearchjobssetattributehref href functionhr job nearfoundationhttphrjobsshrmorgjobssearchresultsradius0location searchtermvaluenearblank var hrefcouncilshrm globalfindlaboraffiliatecouncil for globalspecialif ucchrjobshtmllengthreportspreventactionsearch jobsucchrjobsplaceholderlengthfranciscopress roomshrm global shrmdevelopmentinclusion conferenceucchrjobsplaceholderlength 0function ucchrjobshtml ucchrjobsjob function openinnewwindowanchortagidissuesnavnavbar li afilterfunctionstatesearchjobswidthcertification preparationsearchjobssetattributehref hrefconference3storeshrm0 ucchrjobsplaceholderlength 0join usctl00pageviewtrackerimgtempattrsrclearnglobalcompetency modeleventsfunction returnnotjobdevelopment forumiftermsvirtual register nowfinder findhref function ucchrjobshtmltheirtextboxtagid var searchtermglobal immigrationvar searchtermvar searchjobsucchrjobsplaceholder navnavbar lidiversity inclusion conferenceyourpublicshowmorelessnewstrendssearchtermvalue searchjobssetattributehref hrefsearchjobssetattributetarget blanktrends forecastingucchrjobsplaceholder navnavbarstudentbenefitsmembersucchrjobsimmigrationdocumentgetelementbyidtextboxtagid var searchjobsseeucchrjobs if ucchrjobshtmllengthworkforceucchrjobsplaceholderlength 0 shrmjobfinderucchrjobshtmladdclassshrmminijobfinderfunction return falsesignexpertisejobsshrmcpshrmscp certificationpageinforendertemplatekeysearchjobssetattributetargetucchrjobshtmlshowvar0 searchjobssetattributetargetpageinfodatajob finderalldocumentgetelementbyidtextboxtagid varcertificationucchrjobshtmllength 0 ucchrjobsplaceholderlengthleadershippostindia shrmafilterfunctionsanregistersearchtermvalue searchjobssetattributehrefshrmpageinfopanelsearchtermvaluenwsblockemployeesif searchtermvaluelengthnews shrmpublic policy issuestextboxtagidreturn falseinclusionucchrjobsplaceholderreplacewith ucchrjobshtmlshowroomresourceshrmjobfinderucchrjobshtmladdclassshrmminijobfinder ucchrjobsplaceholderreplacewith ucchrjobshtmlshowdocumentgetelementbyidanchortagid searchjobssetattributehrefemploymentbasedvirtualucchrjobshtml ucchrjobs ucchrjobsplaceholderupfind an hrtitleyou search jobsseptember0pagepropinfodatajob near youemployeeopeninnewwindowanchortagidfalse functionexpositiondatahref functionsearchjobs documentgetelementbyidanchortagidvalueblank varvisnwsblocksshrmcpshrmscptalent acquisition hrtermsworkplaceprioritiesiftodayleadership development forumnewforumdocumentgetelementbyidtextboxtagidcareeryou searchvirtual registertakesearch jobs posttrueucchrjobs ucchrjobsplaceholderjavascriptacquisitionacquisition hrconference expositiondiversitymodel1nwsblocksreturn thistext ucchrjobsnewsserviceafilterfunction return thistextentire siteburnoutbecomeemployee handbook builderjobs posthr people strategyemployersemploymentbased immigration0 shrmjobfinderucchrjobshtmladdclassshrmminijobfinder ucchrjobsplaceholderreplacewithvalucchrjobsplaceholdersrcdiversity inclusionyouucchrjobshtml ucchrjobsurlhr expertisecommunities communitieskeymembershipfunctionwidth 100searchjobssetattributetarget if searchtermvaluelengthucchrjobshtmllengthresearchcompliancesingleregister nowhttphrjobsshrmorgjobssearchresultsradius0locationthistext ucchrjobs ifshrm storeleadership developmentpmagazinesearchterm documentgetelementbyidtextboxtagidpagepeople strategyli afilterfunction returnforecastingtoolsaccesschinahrcompetencypresshumanfinderhandbook builderhtmlsee allsearchtermvaluelength 0 searchjobssetattributetargethttphrjobsshrmorgjobssearchresultsradius0location searchtermvalue searchjobssetattributehrefoctobertipshandbookreturnlearningmanagementfjsdocumentgetelementbyidanchortagid searchjobssetattributehref javascripthr jobpeopleucchrjobshtmllength 0businessucchrjobs ifsearchterm documentgetelementbyidtextboxtagid varpolicy issuessearchjobssetattributetarget blank vardocumentgetelementbyidanchortagidtextboxtagid varnetworkcalcheightentiresearchtermvaluelength2professionalssolutionssitehr peoplecentervar href httphrjobsshrmorgjobssearchresultsradius0location0 shrmjobfinderucchrjobshtmladdclassshrmminijobfinderaugustnavnavbartalent acquisitionvar searchjobs documentgetelementbyidanchortagidopeninnewwindowanchortagid textboxtagid varnear you searchelseacquisition hr expertiseshrm foundationsearchtermmetaquerytaxpreparationsearchjobssetattributetarget ifnavigationemploymentcaninformationjspost a jobnear youvirtuallysearchjobs documentgetelementbyidanchortagid searchjobssetattributehrefnowsurveylegalsearchtermvaluelength 0offjob functionvendorhrefglobal shrmshowchaptersif ucchrjobshtmllength 0shrm india shrmpublic policyfalseucchrjobsplaceholderreplacewithcaliforniaif searchtermvaluelength 0href httphrjobsshrmorgjobssearchresultsradius0locationblanknationalthistextevents shrmthistext ucchrjobsusemployee handbookconnectsearchjobssetattributehref javascript searchjobssetattributetargetmorereturn thistextseminarsazsearchjobssetattributehreffunction openinnewwindowanchortagid textboxtagidshrmjobfinderucchrjobshtmladdclassshrmminijobfindercommunitiessearchopeninnewwindowanchortagid textboxtagiducchrjobs ucchrjobsplaceholder navnavbar

Longtail Keyword Density for Shrm.org

KeywordsOccurences
hr people strategy5
diversity inclusion conference4
post a job4
ucchrjobshtml ucchrjobs ucchrjobsplaceholder3
function ucchrjobshtml ucchrjobs3
ucchrjobs ucchrjobsplaceholder navnavbar3
ucchrjobsplaceholder navnavbar li3
li afilterfunction return3
navnavbar li afilterfunction3
href function ucchrjobshtml3
searchjobssetattributehref href function3
var href httphrjobsshrmorgjobssearchresultsradius0location3
blank var href3
href httphrjobsshrmorgjobssearchresultsradius0location searchtermvalue3
httphrjobsshrmorgjobssearchresultsradius0location searchtermvalue searchjobssetattributehref3
searchtermvalue searchjobssetattributehref href3
afilterfunction return thistext3
return thistext ucchrjobs3
virtual register now3
0 shrm-job-finderucchrjobshtmladdclassshrm-mini-job-finder ucchrjobsplaceholderreplacewith3
shrm-job-finderucchrjobshtmladdclassshrm-mini-job-finder ucchrjobsplaceholderreplacewith ucchrjobshtmlshow3
acquisition hr expertise3
council for global3
ucchrjobsplaceholderlength 0 shrm-job-finderucchrjobshtmladdclassshrm-mini-job-finder3
0 ucchrjobsplaceholderlength 03
thistext ucchrjobs if3
searchjobssetattributetarget blank var3
ucchrjobs if ucchrjobshtmllength3
if ucchrjobshtmllength 03
ucchrjobshtmllength 0 ucchrjobsplaceholderlength3
talent acquisition hr3
if searchtermvaluelength 03
job near you3
hr job near3
near you search3
you search jobs3
job function openinnewwindowanchortagid3
search jobs post3
find an hr3
job finder find3
shrm india shrm3
shrm global shrm3
public policy issues3
employee handbook builder3
leadership development forum3
function openinnewwindowanchortagid textboxtagid3
openinnewwindowanchortagid textboxtagid var3
javascript searchjobssetattributetarget if3
searchjobssetattributehref javascript searchjobssetattributetarget3
searchjobssetattributetarget if searchtermvaluelength3
function return false3
searchtermvaluelength 0 searchjobssetattributetarget3
documentgetelementbyidanchortagid searchjobssetattributehref javascript3
searchjobs documentgetelementbyidanchortagid searchjobssetattributehref3
var searchterm documentgetelementbyidtextboxtagid3
textboxtagid var searchterm3
searchterm documentgetelementbyidtextboxtagid var3
documentgetelementbyidtextboxtagid var searchjobs3
var searchjobs documentgetelementbyidanchortagid3
0 searchjobssetattributetarget blank3
register now10
public policy7
talent acquisition6
diversity inclusion5
hr people5
people strategy5
function return5
employee handbook5
shrm india5
events shrm4
var href4
certification preparation4
hr expertise4
trends forecasting4
shrm foundation4
width 1004
inclusion conference4
conference exposition4
ucchrjobs ucchrjobsplaceholder3
ucchrjobsplaceholder navnavbar3
li afilterfunction3
navnavbar li3
searchtermvaluelength 03
ucchrjobshtml ucchrjobs3
0 searchjobssetattributetarget3
searchjobssetattributehref href3
httphrjobsshrmorgjobssearchresultsradius0location searchtermvalue3
blank var3
href httphrjobsshrmorgjobssearchresultsradius0location3
afilterfunction return3
searchjobssetattributetarget blank3
href function3
searchtermvalue searchjobssetattributehref3
function ucchrjobshtml3
0 ucchrjobsplaceholderlength3
global immigration3
news shrm3
employment-based immigration3
press room3
acquisition hr3
ctl00pageviewtrackerimgtempattrsrc src3
false function3
virtual register3
ucchrjobsplaceholderreplacewith ucchrjobshtmlshow3
shrm-job-finderucchrjobshtmladdclassshrm-mini-job-finder ucchrjobsplaceholderreplacewith3
if ucchrjobshtmllength3
ucchrjobs if3
thistext ucchrjobs3
ucchrjobshtmllength 03
if searchtermvaluelength3
0 shrm-job-finderucchrjobshtmladdclassshrm-mini-job-finder3
ucchrjobsplaceholderlength 03
return thistext3
var searchterm3
leadership development3
shrm-cpshrm-scp certification3
competency model3
development forum3
see all3
communities communities3
join us3
all events3
handbook builder3
policy issues3
global shrm3
shrm global3
return false3
shrm china3
india shrm3
hr magazine3
entire site3
shrm store3
job finder3
finder find3
documentgetelementbyidtextboxtagid var3
searchterm documentgetelementbyidtextboxtagid3
textboxtagid var3
var searchjobs3
searchjobs documentgetelementbyidanchortagid3
javascript searchjobssetattributetarget3
searchjobssetattributehref javascript3
documentgetelementbyidanchortagid searchjobssetattributehref3
openinnewwindowanchortagid textboxtagid3
function openinnewwindowanchortagid3
near you3
job near3
hr job3
you search3
search jobs3
job function3
jobs post3
searchjobssetattributetarget if3
shrm60
hr48
var40
function33
if16
your15
employee14
events14
014
job13
return11
false11
111
resources10
register10
now10
get9
global9
policy8
href8
talent8
news8
conference8
certification8
benefits7
business7
people7
diversity7
student7
public7
virtual7
immigration7
ucchrjobs7
join7
today6
solutions6
acquisition6
us6
more6
tools6
development6
handbook6
site6
search6
searchjobssetattributehref6
searchjobssetattributetarget6
find6
url6
jobs6
all6
you6
26
strategy6
issues6
trends6
learning5
career5
seminars5
shrms5
ifterms5
val5
survey5
member5
competency5
true5
workplace5
management5
thistext5
expertise5
affiliate5
take5
new5
september5
network5
membership5
inclusion5
35
shrmpageinfo-panel5
india5
august5
src5
data5
width5
employment5
up4
p4
key4
their4
workforce4
show4
exposition4
human4
post4
employer4
forum4
employees4
tips4
leadership4
html4
id4
state4
store4
forecasting4
metaquerytax4
center4
sign4
foundation4
learn4
chapters4
communities4
js4
fjs4
october4
preparation4
not4
connect4
press4
san3
ucchrjobsplaceholderlength3
ucchrjobshtmllength3
ctl00pageviewtrackerimgtempattrsrc3
shrm-job-finderucchrjobshtmladdclassshrm-mini-job-finder3
ucchrjobsplaceholderreplacewith3
employment-based3
members3
ucchrjobshtmlshow3
employers3
value3
calcheight3
francisco3
room3
pageinfodata3
national3
height3
m3
terms3
single3
afilterfunction3
priorities3
nwsblocks3
visnwsblocks3
showmorelessnewstrends3
else3
less3
council3
pageinforendertemplatekey3
pagepropinfodata3
nwsblock3
finder3
page3
model3
can3
builder3
a-team3
action3
access3
navigation3
off3
shrm-cpshrm-scp3
virtually3
vendor3
service3
professionals3
labor3
burnout3
prevent3
reports3
research3
california3
advocacy3
compliance3
legal3
china3
see3
event3
resource3
searchtermvaluelength3
javascript3
documentgetelementbyidanchortagid3
searchjobs3
blank3
httphrjobsshrmorgjobssearchresultsradius0location3
navnavbar3
ucchrjobsplaceholder3
ucchrjobshtml3
searchtermvalue3
documentgetelementbyidtextboxtagid3
searchterm3
az3
become3
title3
information3
magazine3
special3
textboxtagid3
openinnewwindowanchortagid3
entire3
near3
li3

What are the nameservers for shrm.org?

Shrm.org Domain Nameserver Information

HostIP AddressCountry
ns3.p02.dynect.net 208.78.71.2United States United States
ns1.p02.dynect.net 208.78.70.2United States United States
ns2.p02.dynect.net 204.13.250.2United States United States
ns4.p02.dynect.net 204.13.251.2United States United States

Shrm.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Shrm.org is a scam?