Shrm.org Summary
High trust score |
SHRM - The Voice of All Things Work
Shrm.org has a High trust score, and a Statvoo Rank of B.
Shrm.org is hosted by Society for Human Resource Management in Maryland, Oxon Hill, United States, 20745.
Shrm.org has an IP Address of 198.22.197.80 and a hostname of www.shrm.org.
The domain shrm.org was registered 2 decades 4 years 4 months ago by , it was last modified 201 decades 9 years 3 months ago and currently is set to expire 201 decades 9 years 3 months ago.
It is the world's 9,487 most popular site among over 300 million websites.
Shrm.org has a total of 0 backlinks.
Shrm.org gets approximately 146,512 unique visitors a day and 1,576,896 pageviews per day.
Shrm.org has an estimated worth of $1703160.
An average daily income of approximately $1577, which is wroughly $47,967 per month.
Whois information for shrm.org
Full Whois Lookup for Shrm.org Whois Lookup
Domain Name: SHRM.ORG
Registry Domain ID: D308459-LROR
Registrar WHOIS Server:
Registrar URL: http://www.enom.com
Updated Date: 2017-04-11T07:53:04Z
Creation Date: 1995-05-09T04:00:00Z
Registry Expiry Date: 2018-05-10T04:00:00Z
Registrar Registration Expiration Date:
Registrar: eNom, Inc.
Registrar IANA ID: 48
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: C102667007-LROR
Registrant Name: Todd Oosterveen
Registrant Organization: Society for Human Resource Management
Registrant Street: 1800 Duke Street
Registrant City: Alexandria
Registrant State/Province: VA
Registrant Postal Code: 22314
Registrant Country: US
Registrant Phone: +1.7036267861
Registrant Phone Ext:
Registrant Fax: +1.7033484473
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C102667007-LROR
Admin Name: Todd Oosterveen
Admin Organization: Society for Human Resource Management
Admin Street: 1800 Duke Street
Admin City: Alexandria
Admin State/Province: VA
Admin Postal Code: 22314
Admin Country: US
Admin Phone: +1.7036267861
Admin Phone Ext:
Admin Fax: +1.7033484473
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C102667007-LROR
Tech Name: Todd Oosterveen
Tech Organization: Society for Human Resource Management
Tech Street: 1800 Duke Street
Tech City: Alexandria
Tech State/Province: VA
Tech Postal Code: 22314
Tech Country: US
Tech Phone: +1.7036267861
Tech Phone Ext:
Tech Fax: +1.7033484473
Tech Fax Ext:
Tech Email: Login to show email
Server: NS3.P02.DYNECT.NET
Name Server: NS1.P02.DYNECT.NET
Name Server: NS2.P02.DYNECT.NET
Name Server: NS4.P02.DYNECT.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-08-17T18:29:10Z
Who hosts Shrm.org?
Shrm.org Web Server Information
| Hosted IP Address: | 198.22.197.80 |
| Hosted Hostname: | www.shrm.org |
| Service Provider: | Society for Human Resource Management |
| Hosted Country: |  US |
| Location Latitude: | 38.803 |
| Location Longitude: | -76.99 |
| Webserver Software: | Not Applicable |
HTTP Header Analysis for Shrm.org
| Http-Version: | 1.1 |
| Status-Code: | 200 |
| Status: | 200 OK |
| Cache-Control: | no-cache |
| Pragma: | no-cache |
| Content-Type: | text/html; charset=utf-8 |
| Expires: | -1 |
| Server: | Microsoft-IIS/7.5 |
| SPRequestGuid: | c3a7059b-0ccf-4cc5-81cb-f94232f89bb3 |
| X-SharePointHealthScore: | 0 |
| X-AspNet-Version: | 2.0.50727 |
| X-Powered-By: | ASP.NET |
| MicrosoftSharePointTeamServices: | 14.0.0.7149 |
| X-MS-InvokeApp: | 1; RequireReadOnly |
| Access-Control-Allow-Origin: | http://l.shrm.org |
| Date: | Fri, 12 Jun 2015 11:36:46 GMT |
| Connection: | close |
| Content-Length: | 97164 |
Need to find out who hosts Shrm.org?
Shrm.org Free SEO Report
Website Inpage Analysis for Shrm.org
| H1 Headings: | 0 | ||
| H2 Headings: | 1 |
IMPORTANT DATES
| |
| H3 Headings: | 3 | Job Finder LOCAL CHAPTERS JOIN THE CONVERSATION | |
| H4 Headings: | 5 | HR Daily Newsletter SHRM WORK AT SHRM ELEVATE HR WORK WITH SHRM | |
| H5 Headings: | 2 | Find an HR Job Near You Find chapters in your area | |
| H6 Headings: | 7 |
#ucc_LocalChapter
SHRM CERTIFICATION
HR Resource Spotlight
Need help with a specific HR issue like ADA or FLSA?
#ucc_HRJobs
Your future depends on you.
| |
| Total IFRAMEs: | 1 | ||
| Total Images: | 9 | ||
| Google Adsense: | Not Applicable | ||
| Google Analytics: | Not Applicable |
Keyword Cloud for Shrm.org
memberscouncil for globalfunction ucchrjobshtml ucchrjobsucchrjobsplaceholderpost a jobfinderall eventsshrmcpshrmscp certificationsearchjobssetattributehref javascript searchjobssetattributetargethttphrjobsshrmorgjobssearchresultsradius0locationnewmembershiphumanhrefsearchjobs documentgetelementbyidanchortagid searchjobssetattributehrefsearchterm documentgetelementbyidtextboxtagidafilterfunction returninclusionfunctionucchrjobshtmllength 0 ucchrjobsplaceholderlength0 shrmjobfinderucchrjobshtmladdclassshrmminijobfinder ucchrjobsplaceholderreplacewithforumsee allblank varifacquisitionbuildernear youtitlevar searchjobs documentgetelementbyidanchortagidspecialhttphrjobsshrmorgjobssearchresultsradius0location searchtermvalue searchjobssetattributehreffunction returnstateucchrjobshtml ucchrjobsblankcanucchrjobsplaceholder navnavbarprioritiesstudentfunction ucchrjobshtmllearningexpositionmemberlessexpertisehtmlhref httphrjobsshrmorgjobssearchresultsradius0location searchtermvalueleadership development forumshrm chinafunction openinnewwindowanchortagid textboxtagidnewsopeninnewwindowanchortagid textboxtagidfunction openinnewwindowanchortagidctl00pageviewtrackerimgtempattrsrcemployeescertificationyourresourceshttphrjobsshrmorgjobssearchresultsradius0location searchtermvaluemsearchjobssetattributehref hrefsearchtermvaluelength 0near you searchall0 ucchrjobsplaceholderlength 0urlucchrjobsplaceholderreplacewithvarpublicthistextforecastingsearch jobs postbenefitsmoresearchjobssetattributetarget blank varpolicyeventsignmodelsingleregisternationalvar searchterm documentgetelementbyidtextboxtagidindiaemployerregister nowtheiradvocacy0 searchjobssetattributetargetcompetencyateamdevelopment forumnottodayeventspreventshrm indiasearchtermvaluelengthfoundationsearchtermworkplacedevelopmentpublic policyvirtualsurveytermsfunction return falsetextboxtagid varsiteleadershiptextboxtagid var searchtermjavascript searchjobssetattributetarget ifissuescertification preparationsearchtermvalue searchjobssetattributehrefwidth 100shrmemployee handbook buildershrm india shrmucchrjobs ucchrjobsplaceholder navnavbaryoutakesearchjobssetattributetarget ifshrm storeucchrjobs ifnews shrmucchrjobsplaceholderlength 0ucchrjobshtmllength 0hr jobkeyreturn thistextjob nearhr magazineucchrjobshtmllengthjobs postnowcompetency modelemploymentevents shrmpeopleshowmorelessnewstrendsif searchtermvaluelength 0nwsblockpolicy issuesshrmjobfinderucchrjobshtmladdclassshrmminijobfinder ucchrjobsplaceholderreplacewith ucchrjobshtmlshowtrendshref function ucchrjobshtmlazservicesolutionsshrmjobfinderucchrjobshtmladdclassshrmminijobfinderctl00pageviewtrackerimgtempattrsrc srcsearchtermvaluelength 0 searchjobssetattributetargetpeople strategypress roomshrmpageinfopanelworkforcesearchjobssetattributehref javascriptcomplianceelseafilterfunction return thistextjoinjob finder findvalueyou search jobscalcheightnwsblockssearchtermvalue searchjobssetattributehref hreftoolsreturn falsedocumentgetelementbyidtextboxtagid var searchjobspreparationfalsepublic policy issueslaborucchrjobshtmlaffiliateemployerschaptersucchrjobsplaceholder navnavbar lisearchtermvaluecommunitieshrdocumentgetelementbyidanchortagidtalentjavascriptjobpostseminarsucchrjobsplaceholderlength 0 shrmjobfinderucchrjobshtmladdclassshrmminijobfindermanagementbecomenavigationindia shrm0 ucchrjobsplaceholderlengthnavnavbar li afilterfunctionupemployee handbook1searchjobssetattributetargettalent acquisition hrentiresearchjobsaccesshref httphrjobsshrmorgjobssearchresultsradius0locationucchrjobshtmlshownearhref functionnavnavbarsearchjobssetattributehrefacquisition hr expertiseroominclusion conferencehandbookhr job nearpageinforendertemplatekeyjsconnectacquisition hrjob finderucchrjobs if ucchrjobshtmllengthvirtual register nowshrmjobfinderucchrjobshtmladdclassshrmminijobfinder ucchrjobsplaceholderreplacewithpagepropinfodatablank var href3documentgetelementbyidanchortagid searchjobssetattributehref javascriptif ucchrjobshtmllength 0li afilterfunction returndiversity inclusion conferencevalbusinessvar searchjobsprofessionalsmetaquerytaxresearchleadership developmentiftermsshowglobal immigrationreturn thistext ucchrjobsshrmcpshrmscpjobshr people strategyemploymentbased immigrationhr expertiseheightliucchrjobsplaceholderreplacewith ucchrjobshtmlshowvar href httphrjobsshrmorgjobssearchresultsradius0locationidustalent acquisitionsearchjobssetattributetarget if searchtermvaluelengthsearchterm documentgetelementbyidtextboxtagid vardiversity inclusionpresspresourcevisnwsblocksreturndocumentgetelementbyidtextboxtagidnetworkentire sitejob near you2pagejoin usvar hrefseefind an hrcaliforniasrcfalse functionfindgetimmigrationglobalsearch jobsemployeetextboxtagiducchrjobshtml ucchrjobs ucchrjobsplaceholderopeninnewwindowanchortagidcareerdataif searchtermvaluelengthjavascript searchjobssetattributetargetsearchjobssetattributetarget blankoctobersearchglobal shrmseptemberthistext ucchrjobsshrmscouncilstrategycommunities communitiestrends forecastingif ucchrjobshtmllengthsearchjobssetattributehref href functioninformationdocumentgetelementbyidanchortagid searchjobssetattributehreffinder findli afilterfunctioncenterucchrjobsplaceholderlengthopeninnewwindowanchortagid textboxtagid varucchrjobs ucchrjobsplaceholdervirtuallypageinfodatavar searchtermburnoutwidthmagazineshrm global shrmfrancisconavnavbar lijob function openinnewwindowanchortagiddiversityaugustlegaltipsyou search0 searchjobssetattributetarget blankucchrjobshandbook builderthistext ucchrjobs ifoffvendorlearnshrm global0reportsjob functionconferenceaction0 shrmjobfinderucchrjobshtmladdclassshrmminijobfinderhr peopleshrm foundationfjschinavirtual registerconference expositiontruesanstoreafilterfunctiondocumentgetelementbyidtextboxtagid varemploymentbasedsearchjobs documentgetelementbyidanchortagid
Longtail Keyword Density for Shrm.org
| Keywords | Occurences |
|---|---|
| hr people strategy | 5 |
| diversity inclusion conference | 4 |
| post a job | 4 |
| ucchrjobshtml ucchrjobs ucchrjobsplaceholder | 3 |
| function ucchrjobshtml ucchrjobs | 3 |
| ucchrjobs ucchrjobsplaceholder navnavbar | 3 |
| ucchrjobsplaceholder navnavbar li | 3 |
| li afilterfunction return | 3 |
| navnavbar li afilterfunction | 3 |
| href function ucchrjobshtml | 3 |
| searchjobssetattributehref href function | 3 |
| var href httphrjobsshrmorgjobssearchresultsradius0location | 3 |
| blank var href | 3 |
| href httphrjobsshrmorgjobssearchresultsradius0location searchtermvalue | 3 |
| httphrjobsshrmorgjobssearchresultsradius0location searchtermvalue searchjobssetattributehref | 3 |
| searchtermvalue searchjobssetattributehref href | 3 |
| afilterfunction return thistext | 3 |
| return thistext ucchrjobs | 3 |
| virtual register now | 3 |
| 0 shrm-job-finderucchrjobshtmladdclassshrm-mini-job-finder ucchrjobsplaceholderreplacewith | 3 |
| shrm-job-finderucchrjobshtmladdclassshrm-mini-job-finder ucchrjobsplaceholderreplacewith ucchrjobshtmlshow | 3 |
| acquisition hr expertise | 3 |
| council for global | 3 |
| ucchrjobsplaceholderlength 0 shrm-job-finderucchrjobshtmladdclassshrm-mini-job-finder | 3 |
| 0 ucchrjobsplaceholderlength 0 | 3 |
| thistext ucchrjobs if | 3 |
| searchjobssetattributetarget blank var | 3 |
| ucchrjobs if ucchrjobshtmllength | 3 |
| if ucchrjobshtmllength 0 | 3 |
| ucchrjobshtmllength 0 ucchrjobsplaceholderlength | 3 |
| talent acquisition hr | 3 |
| if searchtermvaluelength 0 | 3 |
| job near you | 3 |
| hr job near | 3 |
| near you search | 3 |
| you search jobs | 3 |
| job function openinnewwindowanchortagid | 3 |
| search jobs post | 3 |
| find an hr | 3 |
| job finder find | 3 |
| shrm india shrm | 3 |
| shrm global shrm | 3 |
| public policy issues | 3 |
| employee handbook builder | 3 |
| leadership development forum | 3 |
| function openinnewwindowanchortagid textboxtagid | 3 |
| openinnewwindowanchortagid textboxtagid var | 3 |
| javascript searchjobssetattributetarget if | 3 |
| searchjobssetattributehref javascript searchjobssetattributetarget | 3 |
| searchjobssetattributetarget if searchtermvaluelength | 3 |
| function return false | 3 |
| searchtermvaluelength 0 searchjobssetattributetarget | 3 |
| documentgetelementbyidanchortagid searchjobssetattributehref javascript | 3 |
| searchjobs documentgetelementbyidanchortagid searchjobssetattributehref | 3 |
| var searchterm documentgetelementbyidtextboxtagid | 3 |
| textboxtagid var searchterm | 3 |
| searchterm documentgetelementbyidtextboxtagid var | 3 |
| documentgetelementbyidtextboxtagid var searchjobs | 3 |
| var searchjobs documentgetelementbyidanchortagid | 3 |
| 0 searchjobssetattributetarget blank | 3 |
| register now | 10 |
| public policy | 7 |
| talent acquisition | 6 |
| diversity inclusion | 5 |
| hr people | 5 |
| people strategy | 5 |
| function return | 5 |
| employee handbook | 5 |
| shrm india | 5 |
| events shrm | 4 |
| var href | 4 |
| certification preparation | 4 |
| hr expertise | 4 |
| trends forecasting | 4 |
| shrm foundation | 4 |
| width 100 | 4 |
| inclusion conference | 4 |
| conference exposition | 4 |
| ucchrjobs ucchrjobsplaceholder | 3 |
| ucchrjobsplaceholder navnavbar | 3 |
| li afilterfunction | 3 |
| navnavbar li | 3 |
| searchtermvaluelength 0 | 3 |
| ucchrjobshtml ucchrjobs | 3 |
| 0 searchjobssetattributetarget | 3 |
| searchjobssetattributehref href | 3 |
| httphrjobsshrmorgjobssearchresultsradius0location searchtermvalue | 3 |
| blank var | 3 |
| href httphrjobsshrmorgjobssearchresultsradius0location | 3 |
| afilterfunction return | 3 |
| searchjobssetattributetarget blank | 3 |
| href function | 3 |
| searchtermvalue searchjobssetattributehref | 3 |
| function ucchrjobshtml | 3 |
| 0 ucchrjobsplaceholderlength | 3 |
| global immigration | 3 |
| news shrm | 3 |
| employment-based immigration | 3 |
| press room | 3 |
| acquisition hr | 3 |
| ctl00pageviewtrackerimgtempattrsrc src | 3 |
| false function | 3 |
| virtual register | 3 |
| ucchrjobsplaceholderreplacewith ucchrjobshtmlshow | 3 |
| shrm-job-finderucchrjobshtmladdclassshrm-mini-job-finder ucchrjobsplaceholderreplacewith | 3 |
| if ucchrjobshtmllength | 3 |
| ucchrjobs if | 3 |
| thistext ucchrjobs | 3 |
| ucchrjobshtmllength 0 | 3 |
| if searchtermvaluelength | 3 |
| 0 shrm-job-finderucchrjobshtmladdclassshrm-mini-job-finder | 3 |
| ucchrjobsplaceholderlength 0 | 3 |
| return thistext | 3 |
| var searchterm | 3 |
| leadership development | 3 |
| shrm-cpshrm-scp certification | 3 |
| competency model | 3 |
| development forum | 3 |
| see all | 3 |
| communities communities | 3 |
| join us | 3 |
| all events | 3 |
| handbook builder | 3 |
| policy issues | 3 |
| global shrm | 3 |
| shrm global | 3 |
| return false | 3 |
| shrm china | 3 |
| india shrm | 3 |
| hr magazine | 3 |
| entire site | 3 |
| shrm store | 3 |
| job finder | 3 |
| finder find | 3 |
| documentgetelementbyidtextboxtagid var | 3 |
| searchterm documentgetelementbyidtextboxtagid | 3 |
| textboxtagid var | 3 |
| var searchjobs | 3 |
| searchjobs documentgetelementbyidanchortagid | 3 |
| javascript searchjobssetattributetarget | 3 |
| searchjobssetattributehref javascript | 3 |
| documentgetelementbyidanchortagid searchjobssetattributehref | 3 |
| openinnewwindowanchortagid textboxtagid | 3 |
| function openinnewwindowanchortagid | 3 |
| near you | 3 |
| job near | 3 |
| hr job | 3 |
| you search | 3 |
| search jobs | 3 |
| job function | 3 |
| jobs post | 3 |
| searchjobssetattributetarget if | 3 |
| shrm | 60 |
| hr | 48 |
| var | 40 |
| function | 33 |
| if | 16 |
| your | 15 |
| employee | 14 |
| events | 14 |
| 0 | 14 |
| job | 13 |
| return | 11 |
| false | 11 |
| 1 | 11 |
| resources | 10 |
| register | 10 |
| now | 10 |
| get | 9 |
| global | 9 |
| policy | 8 |
| href | 8 |
| talent | 8 |
| news | 8 |
| conference | 8 |
| certification | 8 |
| benefits | 7 |
| business | 7 |
| people | 7 |
| diversity | 7 |
| student | 7 |
| public | 7 |
| virtual | 7 |
| immigration | 7 |
| ucchrjobs | 7 |
| join | 7 |
| today | 6 |
| solutions | 6 |
| acquisition | 6 |
| us | 6 |
| more | 6 |
| tools | 6 |
| development | 6 |
| handbook | 6 |
| site | 6 |
| search | 6 |
| searchjobssetattributehref | 6 |
| searchjobssetattributetarget | 6 |
| find | 6 |
| url | 6 |
| jobs | 6 |
| all | 6 |
| you | 6 |
| 2 | 6 |
| strategy | 6 |
| issues | 6 |
| trends | 6 |
| learning | 5 |
| career | 5 |
| seminars | 5 |
| shrms | 5 |
| ifterms | 5 |
| val | 5 |
| survey | 5 |
| member | 5 |
| competency | 5 |
| true | 5 |
| workplace | 5 |
| management | 5 |
| thistext | 5 |
| expertise | 5 |
| affiliate | 5 |
| take | 5 |
| new | 5 |
| september | 5 |
| network | 5 |
| membership | 5 |
| inclusion | 5 |
| 3 | 5 |
| shrmpageinfo-panel | 5 |
| india | 5 |
| august | 5 |
| src | 5 |
| data | 5 |
| width | 5 |
| employment | 5 |
| up | 4 |
| p | 4 |
| key | 4 |
| their | 4 |
| workforce | 4 |
| show | 4 |
| exposition | 4 |
| human | 4 |
| post | 4 |
| employer | 4 |
| forum | 4 |
| employees | 4 |
| tips | 4 |
| leadership | 4 |
| html | 4 |
| id | 4 |
| state | 4 |
| store | 4 |
| forecasting | 4 |
| metaquerytax | 4 |
| center | 4 |
| sign | 4 |
| foundation | 4 |
| learn | 4 |
| chapters | 4 |
| communities | 4 |
| js | 4 |
| fjs | 4 |
| october | 4 |
| preparation | 4 |
| not | 4 |
| connect | 4 |
| press | 4 |
| san | 3 |
| ucchrjobsplaceholderlength | 3 |
| ucchrjobshtmllength | 3 |
| ctl00pageviewtrackerimgtempattrsrc | 3 |
| shrm-job-finderucchrjobshtmladdclassshrm-mini-job-finder | 3 |
| ucchrjobsplaceholderreplacewith | 3 |
| employment-based | 3 |
| members | 3 |
| ucchrjobshtmlshow | 3 |
| employers | 3 |
| value | 3 |
| calcheight | 3 |
| francisco | 3 |
| room | 3 |
| pageinfodata | 3 |
| national | 3 |
| height | 3 |
| m | 3 |
| terms | 3 |
| single | 3 |
| afilterfunction | 3 |
| priorities | 3 |
| nwsblocks | 3 |
| visnwsblocks | 3 |
| showmorelessnewstrends | 3 |
| else | 3 |
| less | 3 |
| council | 3 |
| pageinforendertemplatekey | 3 |
| pagepropinfodata | 3 |
| nwsblock | 3 |
| finder | 3 |
| page | 3 |
| model | 3 |
| can | 3 |
| builder | 3 |
| a-team | 3 |
| action | 3 |
| access | 3 |
| navigation | 3 |
| off | 3 |
| shrm-cpshrm-scp | 3 |
| virtually | 3 |
| vendor | 3 |
| service | 3 |
| professionals | 3 |
| labor | 3 |
| burnout | 3 |
| prevent | 3 |
| reports | 3 |
| research | 3 |
| california | 3 |
| advocacy | 3 |
| compliance | 3 |
| legal | 3 |
| china | 3 |
| see | 3 |
| event | 3 |
| resource | 3 |
| searchtermvaluelength | 3 |
| javascript | 3 |
| documentgetelementbyidanchortagid | 3 |
| searchjobs | 3 |
| blank | 3 |
| httphrjobsshrmorgjobssearchresultsradius0location | 3 |
| navnavbar | 3 |
| ucchrjobsplaceholder | 3 |
| ucchrjobshtml | 3 |
| searchtermvalue | 3 |
| documentgetelementbyidtextboxtagid | 3 |
| searchterm | 3 |
| az | 3 |
| become | 3 |
| title | 3 |
| information | 3 |
| magazine | 3 |
| special | 3 |
| textboxtagid | 3 |
| openinnewwindowanchortagid | 3 |
| entire | 3 |
| near | 3 |
| li | 3 |
What are the nameservers for shrm.org?
Shrm.org Domain Nameserver Information
| Host | IP Address | Country | |
|---|---|---|---|
| ns3.p02.dynect.net |  | 208.78.71.2 | United States |
| ns1.p02.dynect.net | | 208.78.70.2 | United States |
| ns2.p02.dynect.net | | 204.13.250.2 | United States |
| ns4.p02.dynect.net | | 204.13.251.2 | United States |