Summary  |  
High trust score  | 
SHRM - The Voice of All Things Work has a High trust score, and a Statvoo Rank of B. is hosted by Society for Human Resource Management in Maryland, Oxon Hill, United States, 20745. has an IP Address of and a hostname of

The domain was registered 2 decades 4 years 4 months ago by , it was last modified 201 decades 9 years 3 months ago and currently is set to expire 201 decades 9 years 3 months ago.

It is the world's 9,487 most popular site among over 300 million websites. has a total of 0 backlinks. gets approximately 146,512 unique visitors a day and 1,576,896 pageviews per day. has an estimated worth of $1703160.
An average daily income of approximately $1577, which is wroughly $47,967 per month.

Whois information for

Full Whois Lookup for Whois Lookup

Domain Name: SHRM.ORG
Registry Domain ID: D308459-LROR
Registrar WHOIS Server:
Registrar URL:
Updated Date: 2017-04-11T07:53:04Z
Creation Date: 1995-05-09T04:00:00Z
Registry Expiry Date: 2018-05-10T04:00:00Z
Registrar Registration Expiration Date:
Registrar: eNom, Inc.
Registrar IANA ID: 48
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited
Registry Registrant ID: C102667007-LROR
Registrant Name: Todd Oosterveen
Registrant Organization: Society for Human Resource Management
Registrant Street: 1800 Duke Street
Registrant City: Alexandria
Registrant State/Province: VA
Registrant Postal Code: 22314
Registrant Country: US
Registrant Phone: +1.7036267861
Registrant Phone Ext:
Registrant Fax: +1.7033484473
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C102667007-LROR
Admin Name: Todd Oosterveen
Admin Organization: Society for Human Resource Management
Admin Street: 1800 Duke Street
Admin City: Alexandria
Admin State/Province: VA
Admin Postal Code: 22314
Admin Country: US
Admin Phone: +1.7036267861
Admin Phone Ext:
Admin Fax: +1.7033484473
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C102667007-LROR
Tech Name: Todd Oosterveen
Tech Organization: Society for Human Resource Management
Tech Street: 1800 Duke Street
Tech City: Alexandria
Tech State/Province: VA
Tech Postal Code: 22314
Tech Country: US
Tech Phone: +1.7036267861
Tech Phone Ext:
Tech Fax: +1.7033484473
Tech Fax Ext:
Tech Email: Login to show email
Server: NS3.P02.DYNECT.NET
Name Server: NS1.P02.DYNECT.NET
Name Server: NS2.P02.DYNECT.NET
Name Server: NS4.P02.DYNECT.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form:
>>> Last update of WHOIS database: 2017-08-17T18:29:10Z

Who hosts Web Server Information

Hosted IP Address:
Service Provider:Society for Human Resource Management
Hosted Country:United StatesUS
Location Latitude:38.803
Location Longitude:-76.99
Webserver Software:Not Applicable

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: no-cache
Pragma: no-cache
Content-Type: text/html; charset=utf-8
Expires: -1
Server: Microsoft-IIS/7.5
SPRequestGuid: c3a7059b-0ccf-4cc5-81cb-f94232f89bb3
X-SharePointHealthScore: 0
X-AspNet-Version: 2.0.50727
X-Powered-By: ASP.NET
X-MS-InvokeApp: 1; RequireReadOnly
Date: Fri, 12 Jun 2015 11:36:46 GMT
Connection: close
Content-Length: 97164

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:1
H3 Headings:3
Job Finder
H4 Headings:5
HR Daily Newsletter
H5 Headings:2
Find an HR Job Near You
Find chapters in your area
H6 Headings:7
HR Resource Spotlight
Need help with a specific HR issue like ADA or FLSA?
Your future depends on you.
Total IFRAMEs:1
Total Images:9
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

memberscouncil for globalfunction ucchrjobshtml ucchrjobsucchrjobsplaceholderpost a jobfinderall eventsshrmcpshrmscp certificationsearchjobssetattributehref javascript searchjobssetattributetargethttphrjobsshrmorgjobssearchresultsradius0locationnewmembershiphumanhrefsearchjobs documentgetelementbyidanchortagid searchjobssetattributehrefsearchterm documentgetelementbyidtextboxtagidafilterfunction returninclusionfunctionucchrjobshtmllength 0 ucchrjobsplaceholderlength0 shrmjobfinderucchrjobshtmladdclassshrmminijobfinder ucchrjobsplaceholderreplacewithforumsee allblank varifacquisitionbuildernear youtitlevar searchjobs documentgetelementbyidanchortagidspecialhttphrjobsshrmorgjobssearchresultsradius0location searchtermvalue searchjobssetattributehreffunction returnstateucchrjobshtml ucchrjobsblankcanucchrjobsplaceholder navnavbarprioritiesstudentfunction ucchrjobshtmllearningexpositionmemberlessexpertisehtmlhref httphrjobsshrmorgjobssearchresultsradius0location searchtermvalueleadership development forumshrm chinafunction openinnewwindowanchortagid textboxtagidnewsopeninnewwindowanchortagid textboxtagidfunction openinnewwindowanchortagidctl00pageviewtrackerimgtempattrsrcemployeescertificationyourresourceshttphrjobsshrmorgjobssearchresultsradius0location searchtermvaluemsearchjobssetattributehref hrefsearchtermvaluelength 0near you searchall0 ucchrjobsplaceholderlength 0urlucchrjobsplaceholderreplacewithvarpublicthistextforecastingsearch jobs postbenefitsmoresearchjobssetattributetarget blank varpolicyeventsignmodelsingleregisternationalvar searchterm documentgetelementbyidtextboxtagidindiaemployerregister nowtheiradvocacy0 searchjobssetattributetargetcompetencyateamdevelopment forumnottodayeventspreventshrm indiasearchtermvaluelengthfoundationsearchtermworkplacedevelopmentpublic policyvirtualsurveytermsfunction return falsetextboxtagid varsiteleadershiptextboxtagid var searchtermjavascript searchjobssetattributetarget ifissuescertification preparationsearchtermvalue searchjobssetattributehrefwidth 100shrmemployee handbook buildershrm india shrmucchrjobs ucchrjobsplaceholder navnavbaryoutakesearchjobssetattributetarget ifshrm storeucchrjobs ifnews shrmucchrjobsplaceholderlength 0ucchrjobshtmllength 0hr jobkeyreturn thistextjob nearhr magazineucchrjobshtmllengthjobs postnowcompetency modelemploymentevents shrmpeopleshowmorelessnewstrendsif searchtermvaluelength 0nwsblockpolicy issuesshrmjobfinderucchrjobshtmladdclassshrmminijobfinder ucchrjobsplaceholderreplacewith ucchrjobshtmlshowtrendshref function ucchrjobshtmlazservicesolutionsshrmjobfinderucchrjobshtmladdclassshrmminijobfinderctl00pageviewtrackerimgtempattrsrc srcsearchtermvaluelength 0 searchjobssetattributetargetpeople strategypress roomshrmpageinfopanelworkforcesearchjobssetattributehref javascriptcomplianceelseafilterfunction return thistextjoinjob finder findvalueyou search jobscalcheightnwsblockssearchtermvalue searchjobssetattributehref hreftoolsreturn falsedocumentgetelementbyidtextboxtagid var searchjobspreparationfalsepublic policy issueslaborucchrjobshtmlaffiliateemployerschaptersucchrjobsplaceholder navnavbar lisearchtermvaluecommunitieshrdocumentgetelementbyidanchortagidtalentjavascriptjobpostseminarsucchrjobsplaceholderlength 0 shrmjobfinderucchrjobshtmladdclassshrmminijobfindermanagementbecomenavigationindia shrm0 ucchrjobsplaceholderlengthnavnavbar li afilterfunctionupemployee handbook1searchjobssetattributetargettalent acquisition hrentiresearchjobsaccesshref httphrjobsshrmorgjobssearchresultsradius0locationucchrjobshtmlshownearhref functionnavnavbarsearchjobssetattributehrefacquisition hr expertiseroominclusion conferencehandbookhr job nearpageinforendertemplatekeyjsconnectacquisition hrjob finderucchrjobs if ucchrjobshtmllengthvirtual register nowshrmjobfinderucchrjobshtmladdclassshrmminijobfinder ucchrjobsplaceholderreplacewithpagepropinfodatablank var href3documentgetelementbyidanchortagid searchjobssetattributehref javascriptif ucchrjobshtmllength 0li afilterfunction returndiversity inclusion conferencevalbusinessvar searchjobsprofessionalsmetaquerytaxresearchleadership developmentiftermsshowglobal immigrationreturn thistext ucchrjobsshrmcpshrmscpjobshr people strategyemploymentbased immigrationhr expertiseheightliucchrjobsplaceholderreplacewith ucchrjobshtmlshowvar href httphrjobsshrmorgjobssearchresultsradius0locationidustalent acquisitionsearchjobssetattributetarget if searchtermvaluelengthsearchterm documentgetelementbyidtextboxtagid vardiversity inclusionpresspresourcevisnwsblocksreturndocumentgetelementbyidtextboxtagidnetworkentire sitejob near you2pagejoin usvar hrefseefind an hrcaliforniasrcfalse functionfindgetimmigrationglobalsearch jobsemployeetextboxtagiducchrjobshtml ucchrjobs ucchrjobsplaceholderopeninnewwindowanchortagidcareerdataif searchtermvaluelengthjavascript searchjobssetattributetargetsearchjobssetattributetarget blankoctobersearchglobal shrmseptemberthistext ucchrjobsshrmscouncilstrategycommunities communitiestrends forecastingif ucchrjobshtmllengthsearchjobssetattributehref href functioninformationdocumentgetelementbyidanchortagid searchjobssetattributehreffinder findli afilterfunctioncenterucchrjobsplaceholderlengthopeninnewwindowanchortagid textboxtagid varucchrjobs ucchrjobsplaceholdervirtuallypageinfodatavar searchtermburnoutwidthmagazineshrm global shrmfrancisconavnavbar lijob function openinnewwindowanchortagiddiversityaugustlegaltipsyou search0 searchjobssetattributetarget blankucchrjobshandbook builderthistext ucchrjobs ifoffvendorlearnshrm global0reportsjob functionconferenceaction0 shrmjobfinderucchrjobshtmladdclassshrmminijobfinderhr peopleshrm foundationfjschinavirtual registerconference expositiontruesanstoreafilterfunctiondocumentgetelementbyidtextboxtagid varemploymentbasedsearchjobs documentgetelementbyidanchortagid

Longtail Keyword Density for

hr people strategy5
diversity inclusion conference4
post a job4
ucchrjobshtml ucchrjobs ucchrjobsplaceholder3
function ucchrjobshtml ucchrjobs3
ucchrjobs ucchrjobsplaceholder navnavbar3
ucchrjobsplaceholder navnavbar li3
li afilterfunction return3
navnavbar li afilterfunction3
href function ucchrjobshtml3
searchjobssetattributehref href function3
var href httphrjobsshrmorgjobssearchresultsradius0location3
blank var href3
href httphrjobsshrmorgjobssearchresultsradius0location searchtermvalue3
httphrjobsshrmorgjobssearchresultsradius0location searchtermvalue searchjobssetattributehref3
searchtermvalue searchjobssetattributehref href3
afilterfunction return thistext3
return thistext ucchrjobs3
virtual register now3
0 shrm-job-finderucchrjobshtmladdclassshrm-mini-job-finder ucchrjobsplaceholderreplacewith3
shrm-job-finderucchrjobshtmladdclassshrm-mini-job-finder ucchrjobsplaceholderreplacewith ucchrjobshtmlshow3
acquisition hr expertise3
council for global3
ucchrjobsplaceholderlength 0 shrm-job-finderucchrjobshtmladdclassshrm-mini-job-finder3
0 ucchrjobsplaceholderlength 03
thistext ucchrjobs if3
searchjobssetattributetarget blank var3
ucchrjobs if ucchrjobshtmllength3
if ucchrjobshtmllength 03
ucchrjobshtmllength 0 ucchrjobsplaceholderlength3
talent acquisition hr3
if searchtermvaluelength 03
job near you3
hr job near3
near you search3
you search jobs3
job function openinnewwindowanchortagid3
search jobs post3
find an hr3
job finder find3
shrm india shrm3
shrm global shrm3
public policy issues3
employee handbook builder3
leadership development forum3
function openinnewwindowanchortagid textboxtagid3
openinnewwindowanchortagid textboxtagid var3
javascript searchjobssetattributetarget if3
searchjobssetattributehref javascript searchjobssetattributetarget3
searchjobssetattributetarget if searchtermvaluelength3
function return false3
searchtermvaluelength 0 searchjobssetattributetarget3
documentgetelementbyidanchortagid searchjobssetattributehref javascript3
searchjobs documentgetelementbyidanchortagid searchjobssetattributehref3
var searchterm documentgetelementbyidtextboxtagid3
textboxtagid var searchterm3
searchterm documentgetelementbyidtextboxtagid var3
documentgetelementbyidtextboxtagid var searchjobs3
var searchjobs documentgetelementbyidanchortagid3
0 searchjobssetattributetarget blank3
register now10
public policy7
talent acquisition6
diversity inclusion5
hr people5
people strategy5
function return5
employee handbook5
shrm india5
events shrm4
var href4
certification preparation4
hr expertise4
trends forecasting4
shrm foundation4
width 1004
inclusion conference4
conference exposition4
ucchrjobs ucchrjobsplaceholder3
ucchrjobsplaceholder navnavbar3
li afilterfunction3
navnavbar li3
searchtermvaluelength 03
ucchrjobshtml ucchrjobs3
0 searchjobssetattributetarget3
searchjobssetattributehref href3
httphrjobsshrmorgjobssearchresultsradius0location searchtermvalue3
blank var3
href httphrjobsshrmorgjobssearchresultsradius0location3
afilterfunction return3
searchjobssetattributetarget blank3
href function3
searchtermvalue searchjobssetattributehref3
function ucchrjobshtml3
0 ucchrjobsplaceholderlength3
global immigration3
news shrm3
employment-based immigration3
press room3
acquisition hr3
ctl00pageviewtrackerimgtempattrsrc src3
false function3
virtual register3
ucchrjobsplaceholderreplacewith ucchrjobshtmlshow3
shrm-job-finderucchrjobshtmladdclassshrm-mini-job-finder ucchrjobsplaceholderreplacewith3
if ucchrjobshtmllength3
ucchrjobs if3
thistext ucchrjobs3
ucchrjobshtmllength 03
if searchtermvaluelength3
0 shrm-job-finderucchrjobshtmladdclassshrm-mini-job-finder3
ucchrjobsplaceholderlength 03
return thistext3
var searchterm3
leadership development3
shrm-cpshrm-scp certification3
competency model3
development forum3
see all3
communities communities3
join us3
all events3
handbook builder3
policy issues3
global shrm3
shrm global3
return false3
shrm china3
india shrm3
hr magazine3
entire site3
shrm store3
job finder3
finder find3
documentgetelementbyidtextboxtagid var3
searchterm documentgetelementbyidtextboxtagid3
textboxtagid var3
var searchjobs3
searchjobs documentgetelementbyidanchortagid3
javascript searchjobssetattributetarget3
searchjobssetattributehref javascript3
documentgetelementbyidanchortagid searchjobssetattributehref3
openinnewwindowanchortagid textboxtagid3
function openinnewwindowanchortagid3
near you3
job near3
hr job3
you search3
search jobs3
job function3
jobs post3
searchjobssetattributetarget if3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry States United States States United States States United States States United States Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?