Low trust score |
Shrm.org Website Information
Website Ranks & Scores for Shrm.org
 Statvoo Rank: | C |
 Alexa Rank: | 21,214 |
 Majestic Rank: | 3,474 |
 Domain Authority: | 87% |
 DMOZ Listing: | No |
Whois information for shrm.org
Full Whois Lookup for Shrm.org Whois Lookup
WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Shrm.org. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.
Domain Name: SHRM.ORG
Registry Domain ID: D308459-LROR
Registrar WHOIS Server:
Registrar URL: http://www.enom.com
Updated Date: 2017-04-11T07:53:04Z
Creation Date: 1995-05-09T04:00:00Z
Registry Expiry Date: 2018-05-10T04:00:00Z
Registrar Registration Expiration Date:
Registrar: eNom, Inc.
Registrar IANA ID: 48
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: C102667007-LROR
Registrant Name: Todd Oosterveen
Registrant Organization: Society for Human Resource Management
Registrant Street: 1800 Duke Street
Registrant City: Alexandria
Registrant State/Province: VA
Registrant Postal Code: 22314
Registrant Country: US
Registrant Phone: +1.7036267861
Registrant Phone Ext:
Registrant Fax: +1.7033484473
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C102667007-LROR
Admin Name: Todd Oosterveen
Admin Organization: Society for Human Resource Management
Admin Street: 1800 Duke Street
Admin City: Alexandria
Admin State/Province: VA
Admin Postal Code: 22314
Admin Country: US
Admin Phone: +1.7036267861
Admin Phone Ext:
Admin Fax: +1.7033484473
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C102667007-LROR
Tech Name: Todd Oosterveen
Tech Organization: Society for Human Resource Management
Tech Street: 1800 Duke Street
Tech City: Alexandria
Tech State/Province: VA
Tech Postal Code: 22314
Tech Country: US
Tech Phone: +1.7036267861
Tech Phone Ext:
Tech Fax: +1.7033484473
Tech Fax Ext:
Tech Email: Login to show email
Server: NS3.P02.DYNECT.NET
Name Server: NS1.P02.DYNECT.NET
Name Server: NS2.P02.DYNECT.NET
Name Server: NS4.P02.DYNECT.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-08-17T18:29:10Z
Who hosts Shrm.org?
Shrm.org is hosted by Society for Human Resource Management in Maryland, Oxon Hill, United States, 20745.
Shrm.org has an IP Address of 198.22.197.80 and a hostname of www.shrm.org.
Shrm.org Web Server Information
| Hosted IP Address: | 198.22.197.80 |
| Hosted Hostname: | www.shrm.org |
| Service Provider: | Society for Human Resource Management |
| Hosted Country: |  US |
| Location Latitude: | 38.803 |
| Location Longitude: | -76.99 |
| Webserver Software: | Not Applicable |
HTTP Header Analysis for Shrm.org
| Http-Version: | 1.1 |
| Status-Code: | 200 |
| Status: | 200 OK |
| Cache-Control: | no-cache |
| Pragma: | no-cache |
| Content-Type: | text/html; charset=utf-8 |
| Expires: | -1 |
| Server: | Microsoft-IIS/7.5 |
| SPRequestGuid: | c3a7059b-0ccf-4cc5-81cb-f94232f89bb3 |
| X-SharePointHealthScore: | 0 |
| X-AspNet-Version: | 2.0.50727 |
| X-Powered-By: | ASP.NET |
| MicrosoftSharePointTeamServices: | 14.0.0.7149 |
| X-MS-InvokeApp: | 1; RequireReadOnly |
| Access-Control-Allow-Origin: | http://l.shrm.org |
| Date: | Fri, 12 Jun 2015 11:36:46 GMT |
| Connection: | close |
| Content-Length: | 97164 |
Need to find out who hosts Shrm.org?
Shrm.org Free SEO Report
Website Inpage Analysis for Shrm.org
| H1 Headings: | 0 | ||
| H2 Headings: | 0 | ||
| H3 Headings: | 0 | ||
| H4 Headings: | 0 | ||
| H5 Headings: | 0 | ||
| H6 Headings: | 0 | ||
| Total IFRAMEs: | 0 | ||
| Total Images: | 0 | ||
| Google Adsense: | Not Applicable | ||
| Google Analytics: | Not Applicable |
Keyword Cloud for Shrm.org
advocacyhr magazinesearchjobssetattributehref javascriptjob nearfunction ucchrjobshtmlresourceslessshrm chinagetli afilterfunctionpolicylivar searchterm documentgetelementbyidtextboxtagidafilterfunction returnmemberateamtrendsfunction openinnewwindowanchortagidctl00pageviewtrackerimgtempattrsrc srcmhref httphrjobsshrmorgjobssearchresultsradius0location searchtermvalueshrmjobfinderucchrjobshtmladdclassshrmminijobfinder ucchrjobsplaceholderreplacewithjoin0 searchjobssetattributetarget blankindia0 ucchrjobsplaceholderlengtheventbuilderheightstrategyidshrmsvar hrefjavascript searchjobssetattributetargetucchrjobshtmltalentemployerjavascript searchjobssetattributetarget ifshrm indiaall eventsjob finder findnavnavbar lisearchjobssetattributehref href functionhr job nearfoundationhttphrjobsshrmorgjobssearchresultsradius0location searchtermvaluenearblank var hrefcouncilshrm globalfindlaboraffiliatecouncil for globalspecialif ucchrjobshtmllengthreportspreventactionsearch jobsucchrjobsplaceholderlengthfranciscopress roomshrm global shrmdevelopmentinclusion conferenceucchrjobsplaceholderlength 0function ucchrjobshtml ucchrjobsjob function openinnewwindowanchortagidissuesnavnavbar li afilterfunctionstatesearchjobswidthcertification preparationsearchjobssetattributehref hrefconference3storeshrm0 ucchrjobsplaceholderlength 0join usctl00pageviewtrackerimgtempattrsrclearnglobalcompetency modeleventsfunction returnnotjobdevelopment forumiftermsvirtual register nowfinder findhref function ucchrjobshtmltheirtextboxtagid var searchtermglobal immigrationvar searchtermvar searchjobsucchrjobsplaceholder navnavbar lidiversity inclusion conferenceyourpublicshowmorelessnewstrendssearchtermvalue searchjobssetattributehref hrefsearchjobssetattributetarget blanktrends forecastingucchrjobsplaceholder navnavbarstudentbenefitsmembersucchrjobsimmigrationdocumentgetelementbyidtextboxtagid var searchjobsseeucchrjobs if ucchrjobshtmllengthworkforceucchrjobsplaceholderlength 0 shrmjobfinderucchrjobshtmladdclassshrmminijobfinderfunction return falsesignexpertisejobsshrmcpshrmscp certificationpageinforendertemplatekeysearchjobssetattributetargetucchrjobshtmlshowvar0 searchjobssetattributetargetpageinfodatajob finderalldocumentgetelementbyidtextboxtagid varcertificationucchrjobshtmllength 0 ucchrjobsplaceholderlengthleadershippostindia shrmafilterfunctionsanregistersearchtermvalue searchjobssetattributehrefshrmpageinfopanelsearchtermvaluenwsblockemployeesif searchtermvaluelengthnews shrmpublic policy issuestextboxtagidreturn falseinclusionucchrjobsplaceholderreplacewith ucchrjobshtmlshowroomresourceshrmjobfinderucchrjobshtmladdclassshrmminijobfinder ucchrjobsplaceholderreplacewith ucchrjobshtmlshowdocumentgetelementbyidanchortagid searchjobssetattributehrefemploymentbasedvirtualucchrjobshtml ucchrjobs ucchrjobsplaceholderupfind an hrtitleyou search jobsseptember0pagepropinfodatajob near youemployeeopeninnewwindowanchortagidfalse functionexpositiondatahref functionsearchjobs documentgetelementbyidanchortagidvalueblank varvisnwsblocksshrmcpshrmscptalent acquisition hrtermsworkplaceprioritiesiftodayleadership development forumnewforumdocumentgetelementbyidtextboxtagidcareeryou searchvirtual registertakesearch jobs posttrueucchrjobs ucchrjobsplaceholderjavascriptacquisitionacquisition hrconference expositiondiversitymodel1nwsblocksreturn thistext ucchrjobsnewsserviceafilterfunction return thistextentire siteburnoutbecomeemployee handbook builderjobs posthr people strategyemployersemploymentbased immigration0 shrmjobfinderucchrjobshtmladdclassshrmminijobfinder ucchrjobsplaceholderreplacewithvalucchrjobsplaceholdersrcdiversity inclusionyouucchrjobshtml ucchrjobsurlhr expertisecommunities communitieskeymembershipfunctionwidth 100searchjobssetattributetarget if searchtermvaluelengthucchrjobshtmllengthresearchcompliancesingleregister nowhttphrjobsshrmorgjobssearchresultsradius0locationthistext ucchrjobs ifshrm storeleadership developmentpmagazinesearchterm documentgetelementbyidtextboxtagidpagepeople strategyli afilterfunction returnforecastingtoolsaccesschinahrcompetencypresshumanfinderhandbook builderhtmlsee allsearchtermvaluelength 0 searchjobssetattributetargethttphrjobsshrmorgjobssearchresultsradius0location searchtermvalue searchjobssetattributehrefoctobertipshandbookreturnlearningmanagementfjsdocumentgetelementbyidanchortagid searchjobssetattributehref javascripthr jobpeopleucchrjobshtmllength 0businessucchrjobs ifsearchterm documentgetelementbyidtextboxtagid varpolicy issuessearchjobssetattributetarget blank vardocumentgetelementbyidanchortagidtextboxtagid varnetworkcalcheightentiresearchtermvaluelength2professionalssolutionssitehr peoplecentervar href httphrjobsshrmorgjobssearchresultsradius0location0 shrmjobfinderucchrjobshtmladdclassshrmminijobfinderaugustnavnavbartalent acquisitionvar searchjobs documentgetelementbyidanchortagidopeninnewwindowanchortagid textboxtagid varnear you searchelseacquisition hr expertiseshrm foundationsearchtermmetaquerytaxpreparationsearchjobssetattributetarget ifnavigationemploymentcaninformationjspost a jobnear youvirtuallysearchjobs documentgetelementbyidanchortagid searchjobssetattributehrefnowsurveylegalsearchtermvaluelength 0offjob functionvendorhrefglobal shrmshowchaptersif ucchrjobshtmllength 0shrm india shrmpublic policyfalseucchrjobsplaceholderreplacewithcaliforniaif searchtermvaluelength 0href httphrjobsshrmorgjobssearchresultsradius0locationblanknationalthistextevents shrmthistext ucchrjobsusemployee handbookconnectsearchjobssetattributehref javascript searchjobssetattributetargetmorereturn thistextseminarsazsearchjobssetattributehreffunction openinnewwindowanchortagid textboxtagidshrmjobfinderucchrjobshtmladdclassshrmminijobfindercommunitiessearchopeninnewwindowanchortagid textboxtagiducchrjobs ucchrjobsplaceholder navnavbar
Longtail Keyword Density for Shrm.org
| Keywords | Occurences |
|---|---|
| hr people strategy | 5 |
| diversity inclusion conference | 4 |
| post a job | 4 |
| ucchrjobshtml ucchrjobs ucchrjobsplaceholder | 3 |
| function ucchrjobshtml ucchrjobs | 3 |
| ucchrjobs ucchrjobsplaceholder navnavbar | 3 |
| ucchrjobsplaceholder navnavbar li | 3 |
| li afilterfunction return | 3 |
| navnavbar li afilterfunction | 3 |
| href function ucchrjobshtml | 3 |
| searchjobssetattributehref href function | 3 |
| var href httphrjobsshrmorgjobssearchresultsradius0location | 3 |
| blank var href | 3 |
| href httphrjobsshrmorgjobssearchresultsradius0location searchtermvalue | 3 |
| httphrjobsshrmorgjobssearchresultsradius0location searchtermvalue searchjobssetattributehref | 3 |
| searchtermvalue searchjobssetattributehref href | 3 |
| afilterfunction return thistext | 3 |
| return thistext ucchrjobs | 3 |
| virtual register now | 3 |
| 0 shrm-job-finderucchrjobshtmladdclassshrm-mini-job-finder ucchrjobsplaceholderreplacewith | 3 |
| shrm-job-finderucchrjobshtmladdclassshrm-mini-job-finder ucchrjobsplaceholderreplacewith ucchrjobshtmlshow | 3 |
| acquisition hr expertise | 3 |
| council for global | 3 |
| ucchrjobsplaceholderlength 0 shrm-job-finderucchrjobshtmladdclassshrm-mini-job-finder | 3 |
| 0 ucchrjobsplaceholderlength 0 | 3 |
| thistext ucchrjobs if | 3 |
| searchjobssetattributetarget blank var | 3 |
| ucchrjobs if ucchrjobshtmllength | 3 |
| if ucchrjobshtmllength 0 | 3 |
| ucchrjobshtmllength 0 ucchrjobsplaceholderlength | 3 |
| talent acquisition hr | 3 |
| if searchtermvaluelength 0 | 3 |
| job near you | 3 |
| hr job near | 3 |
| near you search | 3 |
| you search jobs | 3 |
| job function openinnewwindowanchortagid | 3 |
| search jobs post | 3 |
| find an hr | 3 |
| job finder find | 3 |
| shrm india shrm | 3 |
| shrm global shrm | 3 |
| public policy issues | 3 |
| employee handbook builder | 3 |
| leadership development forum | 3 |
| function openinnewwindowanchortagid textboxtagid | 3 |
| openinnewwindowanchortagid textboxtagid var | 3 |
| javascript searchjobssetattributetarget if | 3 |
| searchjobssetattributehref javascript searchjobssetattributetarget | 3 |
| searchjobssetattributetarget if searchtermvaluelength | 3 |
| function return false | 3 |
| searchtermvaluelength 0 searchjobssetattributetarget | 3 |
| documentgetelementbyidanchortagid searchjobssetattributehref javascript | 3 |
| searchjobs documentgetelementbyidanchortagid searchjobssetattributehref | 3 |
| var searchterm documentgetelementbyidtextboxtagid | 3 |
| textboxtagid var searchterm | 3 |
| searchterm documentgetelementbyidtextboxtagid var | 3 |
| documentgetelementbyidtextboxtagid var searchjobs | 3 |
| var searchjobs documentgetelementbyidanchortagid | 3 |
| 0 searchjobssetattributetarget blank | 3 |
| register now | 10 |
| public policy | 7 |
| talent acquisition | 6 |
| diversity inclusion | 5 |
| hr people | 5 |
| people strategy | 5 |
| function return | 5 |
| employee handbook | 5 |
| shrm india | 5 |
| events shrm | 4 |
| var href | 4 |
| certification preparation | 4 |
| hr expertise | 4 |
| trends forecasting | 4 |
| shrm foundation | 4 |
| width 100 | 4 |
| inclusion conference | 4 |
| conference exposition | 4 |
| ucchrjobs ucchrjobsplaceholder | 3 |
| ucchrjobsplaceholder navnavbar | 3 |
| li afilterfunction | 3 |
| navnavbar li | 3 |
| searchtermvaluelength 0 | 3 |
| ucchrjobshtml ucchrjobs | 3 |
| 0 searchjobssetattributetarget | 3 |
| searchjobssetattributehref href | 3 |
| httphrjobsshrmorgjobssearchresultsradius0location searchtermvalue | 3 |
| blank var | 3 |
| href httphrjobsshrmorgjobssearchresultsradius0location | 3 |
| afilterfunction return | 3 |
| searchjobssetattributetarget blank | 3 |
| href function | 3 |
| searchtermvalue searchjobssetattributehref | 3 |
| function ucchrjobshtml | 3 |
| 0 ucchrjobsplaceholderlength | 3 |
| global immigration | 3 |
| news shrm | 3 |
| employment-based immigration | 3 |
| press room | 3 |
| acquisition hr | 3 |
| ctl00pageviewtrackerimgtempattrsrc src | 3 |
| false function | 3 |
| virtual register | 3 |
| ucchrjobsplaceholderreplacewith ucchrjobshtmlshow | 3 |
| shrm-job-finderucchrjobshtmladdclassshrm-mini-job-finder ucchrjobsplaceholderreplacewith | 3 |
| if ucchrjobshtmllength | 3 |
| ucchrjobs if | 3 |
| thistext ucchrjobs | 3 |
| ucchrjobshtmllength 0 | 3 |
| if searchtermvaluelength | 3 |
| 0 shrm-job-finderucchrjobshtmladdclassshrm-mini-job-finder | 3 |
| ucchrjobsplaceholderlength 0 | 3 |
| return thistext | 3 |
| var searchterm | 3 |
| leadership development | 3 |
| shrm-cpshrm-scp certification | 3 |
| competency model | 3 |
| development forum | 3 |
| see all | 3 |
| communities communities | 3 |
| join us | 3 |
| all events | 3 |
| handbook builder | 3 |
| policy issues | 3 |
| global shrm | 3 |
| shrm global | 3 |
| return false | 3 |
| shrm china | 3 |
| india shrm | 3 |
| hr magazine | 3 |
| entire site | 3 |
| shrm store | 3 |
| job finder | 3 |
| finder find | 3 |
| documentgetelementbyidtextboxtagid var | 3 |
| searchterm documentgetelementbyidtextboxtagid | 3 |
| textboxtagid var | 3 |
| var searchjobs | 3 |
| searchjobs documentgetelementbyidanchortagid | 3 |
| javascript searchjobssetattributetarget | 3 |
| searchjobssetattributehref javascript | 3 |
| documentgetelementbyidanchortagid searchjobssetattributehref | 3 |
| openinnewwindowanchortagid textboxtagid | 3 |
| function openinnewwindowanchortagid | 3 |
| near you | 3 |
| job near | 3 |
| hr job | 3 |
| you search | 3 |
| search jobs | 3 |
| job function | 3 |
| jobs post | 3 |
| searchjobssetattributetarget if | 3 |
| shrm | 60 |
| hr | 48 |
| var | 40 |
| function | 33 |
| if | 16 |
| your | 15 |
| employee | 14 |
| events | 14 |
| 0 | 14 |
| job | 13 |
| return | 11 |
| false | 11 |
| 1 | 11 |
| resources | 10 |
| register | 10 |
| now | 10 |
| get | 9 |
| global | 9 |
| policy | 8 |
| href | 8 |
| talent | 8 |
| news | 8 |
| conference | 8 |
| certification | 8 |
| benefits | 7 |
| business | 7 |
| people | 7 |
| diversity | 7 |
| student | 7 |
| public | 7 |
| virtual | 7 |
| immigration | 7 |
| ucchrjobs | 7 |
| join | 7 |
| today | 6 |
| solutions | 6 |
| acquisition | 6 |
| us | 6 |
| more | 6 |
| tools | 6 |
| development | 6 |
| handbook | 6 |
| site | 6 |
| search | 6 |
| searchjobssetattributehref | 6 |
| searchjobssetattributetarget | 6 |
| find | 6 |
| url | 6 |
| jobs | 6 |
| all | 6 |
| you | 6 |
| 2 | 6 |
| strategy | 6 |
| issues | 6 |
| trends | 6 |
| learning | 5 |
| career | 5 |
| seminars | 5 |
| shrms | 5 |
| ifterms | 5 |
| val | 5 |
| survey | 5 |
| member | 5 |
| competency | 5 |
| true | 5 |
| workplace | 5 |
| management | 5 |
| thistext | 5 |
| expertise | 5 |
| affiliate | 5 |
| take | 5 |
| new | 5 |
| september | 5 |
| network | 5 |
| membership | 5 |
| inclusion | 5 |
| 3 | 5 |
| shrmpageinfo-panel | 5 |
| india | 5 |
| august | 5 |
| src | 5 |
| data | 5 |
| width | 5 |
| employment | 5 |
| up | 4 |
| p | 4 |
| key | 4 |
| their | 4 |
| workforce | 4 |
| show | 4 |
| exposition | 4 |
| human | 4 |
| post | 4 |
| employer | 4 |
| forum | 4 |
| employees | 4 |
| tips | 4 |
| leadership | 4 |
| html | 4 |
| id | 4 |
| state | 4 |
| store | 4 |
| forecasting | 4 |
| metaquerytax | 4 |
| center | 4 |
| sign | 4 |
| foundation | 4 |
| learn | 4 |
| chapters | 4 |
| communities | 4 |
| js | 4 |
| fjs | 4 |
| october | 4 |
| preparation | 4 |
| not | 4 |
| connect | 4 |
| press | 4 |
| san | 3 |
| ucchrjobsplaceholderlength | 3 |
| ucchrjobshtmllength | 3 |
| ctl00pageviewtrackerimgtempattrsrc | 3 |
| shrm-job-finderucchrjobshtmladdclassshrm-mini-job-finder | 3 |
| ucchrjobsplaceholderreplacewith | 3 |
| employment-based | 3 |
| members | 3 |
| ucchrjobshtmlshow | 3 |
| employers | 3 |
| value | 3 |
| calcheight | 3 |
| francisco | 3 |
| room | 3 |
| pageinfodata | 3 |
| national | 3 |
| height | 3 |
| m | 3 |
| terms | 3 |
| single | 3 |
| afilterfunction | 3 |
| priorities | 3 |
| nwsblocks | 3 |
| visnwsblocks | 3 |
| showmorelessnewstrends | 3 |
| else | 3 |
| less | 3 |
| council | 3 |
| pageinforendertemplatekey | 3 |
| pagepropinfodata | 3 |
| nwsblock | 3 |
| finder | 3 |
| page | 3 |
| model | 3 |
| can | 3 |
| builder | 3 |
| a-team | 3 |
| action | 3 |
| access | 3 |
| navigation | 3 |
| off | 3 |
| shrm-cpshrm-scp | 3 |
| virtually | 3 |
| vendor | 3 |
| service | 3 |
| professionals | 3 |
| labor | 3 |
| burnout | 3 |
| prevent | 3 |
| reports | 3 |
| research | 3 |
| california | 3 |
| advocacy | 3 |
| compliance | 3 |
| legal | 3 |
| china | 3 |
| see | 3 |
| event | 3 |
| resource | 3 |
| searchtermvaluelength | 3 |
| javascript | 3 |
| documentgetelementbyidanchortagid | 3 |
| searchjobs | 3 |
| blank | 3 |
| httphrjobsshrmorgjobssearchresultsradius0location | 3 |
| navnavbar | 3 |
| ucchrjobsplaceholder | 3 |
| ucchrjobshtml | 3 |
| searchtermvalue | 3 |
| documentgetelementbyidtextboxtagid | 3 |
| searchterm | 3 |
| az | 3 |
| become | 3 |
| title | 3 |
| information | 3 |
| magazine | 3 |
| special | 3 |
| textboxtagid | 3 |
| openinnewwindowanchortagid | 3 |
| entire | 3 |
| near | 3 |
| li | 3 |
What are the nameservers for shrm.org?
Shrm.org Domain Nameserver Information
| Host | IP Address | Country | |
|---|---|---|---|
| ns3.p02.dynect.net |  | 208.78.71.2 | United States |
| ns1.p02.dynect.net | | 208.78.70.2 | United States |
| ns2.p02.dynect.net | | 204.13.250.2 | United States |
| ns4.p02.dynect.net | | 204.13.251.2 | United States |