Sina.com.cn  |  新浪首页
High trust score  | 
新浪网为全球用户24小时提供全面及时的中文资讯,内容覆盖国内外突发新闻事件、体坛赛事、娱乐时尚、产业资讯、实用信息等,设有新闻、体育、娱乐、财经、科技、房产、汽车等30多个内容频道,同时开设博客、视频、论坛等自由互动交流空间。




Sina.com.cn Website Information

Website Ranks & Scores for Sina.com.cn

Statvoo Rank Statvoo Rank:A+
Alexa Rank Alexa Rank:20
Majestic Rank Majestic Rank:122
Domain Authority Domain Authority:0%
DMOZ DMOZ Listing:No

Domain Information for Sina.com.cn

Domain Registrar: China NIC

Whois information for sina.com.cn

Full Whois Lookup for Sina.com.cn Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Sina.com.cn. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: sina.com.cn
ROID: 20021209s10011s00082127-cn
Domain Status: clientDeleteProhibited
Domain Status: serverDeleteProhibited
Domain Status: clientUpdateProhibited
Domain Status: serverUpdateProhibited
Domain Status: clientTransferProhibited
Domain Status: serverTransferProhibited
Registrant ID: sinacomcn2
Registrant: 北京新浪互联信息服务有限公司
Registrant Contact Email: Login to show email
Registrar: 北京新网数码信息技术有限公司
Name Server: ns1.sina.com.cn
Name Server: ns2.sina.com.cn
Name Server: ns3.sina.com.cn
Name Server: ns4.sina.com.cn
Registration Time: 1998-11-20 00:00:00
Expiration Time: 2019-12-04 09:32:35
DNSSEC: unsigned

Who hosts Sina.com.cn?

Sina.com.cn is hosted by CNCGROUP IP network China169 Beijing Province Network in Beijing, Beijing, China.
Sina.com.cn has an IP Address of 202.108.33.107 and a hostname of 202.108.33.107 and runs PWS/8.2.1.6.3 web server.



Sina.com.cn Web Server Information

Hosted IP Address:202.108.33.107
Hosted Hostname:202.108.33.107
Service Provider:CNCGROUP IP network China169 Beijing Province Network
Hosted Country:ChinaCN
Location Latitude:39.9289
Location Longitude:116.3883
Webserver Software:PWS/8.2.1.6.3

HTTP Header Analysis for Sina.com.cn

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Mon, 18 Apr 2016 15:03:38 GMT
Content-Type: text/html
Last-Modified: Mon, 18 Apr 2016 15:03:25 GMT
Vary: Accept-Encoding
Expires: Mon, 18 Apr 2016 15:04:38 GMT
Cache-Control: max-age=60
X-Powered-By: schi_v1.02
Content-Encoding: gzip
Age: 48
Content-Length: 120996
X-Cache: HIT from ctc.gz.1cf2.42.spool.sina.com.cn


Need to find out who hosts Sina.com.cn?

Sina.com.cn Free SEO Report

Website Inpage Analysis for Sina.com.cn

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Sina.com.cn

var sinahometabinsacachecurindexpxmodtparttfocusscrollupright1 var minsinafunction var spanidmaxfunction id2pxn paramsn sinaadssuccesshandlerid focusscrolldotlistideduadspan0tabadpvpntabadcontent arguments1n varevt func eobjjoinsinaadssuccesshandler function nsinahometabinsid n paramsnifdocumentgetelementbyid sinahometabinsiddocumentgetelementbyididtar eventtargetwindowsinaoutloginlayerislogin18bfocusscrollpre returndocumentgetelementbyidsichannelshowspanstyledisplaysinaadslide01nextstylebackgroundcolor0eduadspan3 0nimgstopfuncdocumentcreateelementscript sinahometabinsclassname sinaadsfunc falsereturn documentgetelementbyidid11functiona varsiweiborecommendwrap lista liobjpagelengtheventsrcelement iftartagname spandimageslengthsinahometabinsclassnamensinaadslide01itemsonestyledisplayc pathfocusscrolllisttype number28sinahometabsc documentcreateelementscript sinahometabinsclassnamevarelse objaddeventlistenereventtypereturn elseask2 ask2r0nfunctionshmrandomnum mathroundmathrandommax minnorepeatfocusscrolllistevent onmouseover focusscrollframewidthhsearchcars searchtypefunc else objaddeventlistenereventtype0eduadspan2lpn varfunction elem typeeobj obj eobjcallback functionjsloaderregisterinforp1ifeobjattachevent objattacheventon evtmouseover functionfocusscrolldotclassname classname focusscrolldotonclassnamesuatrackindexnewpic ilovepicchangeredpointgpushmousedownmod10p 0lnumber focusscrolllisteventcachen joinbsugwrapstyledisplayshm callbacklistb0 returnobjattacheventon eventtype17truesinahometabinsidfunction getrandomobj varobjpagelength 1thismult 1 2false elseratehqpgetrandomobj0 0siweiborecommendwrap27wordnonetrydmaxlenbkeycode10focusscrollcircularlyhotacurmaxlenn n joinmouseoverutf8spanobjaddeventlistenerevtreturnsearchtypefocusscrollspacefocusscrolldotlistidvar randomnumundefinedfocusscrollthismult 1documentcreateelementinsfn12pxfunctiona b varelse objaddeventlistenereventtype funcdocumentcreateelementscriptn n3sinahometabsctype textjavascript sinahometabsctextn vardaddffocusscrollupright falsefunc false elsenumber150l tabadpvlengthp lpnnullsinahometabsctypescrollpic focusscrollscrollcontidsinaadssuccesshandler functionisloginn join spanidappendchildsinahometabinsmin min objpagetorandomnumuniblkt ordermenuelse ifeobjattachevent objattacheventonfortabrandomfunctionbmin 0 varpageviewlinkarraysinaadsvar tabadpveobj ifobjaddeventlistener objaddeventlistenerevtelsemin minobjvar focusscrolltypeofmarginleftetargetmoddjjpfalsename shm callback1 vareasendrequestdcachecuritemtabadcontentcontent0pvn eduadspan012arraysinaads windowsinaadspush sinaadscentertabadcontent arguments1n0eduadspan1 0eduadspan2n elsenpushn elementfocusscrolllistevent onmouseoverfunc eobj eobjcharsetgbk urlelse var sinahometabinstabadpvlengthpminpushneventtargetmod lqfonmouseoverstringtabadpv tabadcontentcontent0pvn eduadspan0idimggetattributedatasrcilovepicchangeredpointmathroundmathrandommax min minregisterframeautolvbforvar p 0lrandomnumfocusscrollautoplay true focusscrollautoplaytimesearchcarswidthelse ifeobjattacheventeobj eobj objthisstatusformsubmitfunction focusscrollnext returnfocusscrollpagewidthwhilesinaads windowsinaads pushilovepicchangeredpoint catchevrpageviewlink tabadpvpnwindowsinaads pushtrue focusscrollinitializeformsetattributeactionfunfunction returndocumentclassname focusscrolldotonclassnameeventtype func elseforvarfunc elsenew scrollpic20height25pxelse varfunction n varvar spanidfocusscrollspace 40function efocusscrollautoplaytime 15 focusscrollcircularlyvar minfocusscroll new scrollpiceobj objlineheighturl urlpbvar max objpagelengthnew scrollpic focusscrollscrollcontidfunction id returnsinahometabins documentcreateelementinsjoin spanidappendchildsinahometabinstabadpvpn sinaadtoolkitsiologpageviewlinkn0eduadspan340 px focusscrollautoplayeventtarget eventsrcelement iftartagnameamaxlennumber focusscrolllistevent onmouseoverobjpagetorandomnumpushn element documentgetelementbyid24var sinahometabsc documentcreateelementscript9span try suatrackindexnewpicobj eobj ifobjaddeventlistenertrue focusscrollautoplaytime 1523pxbackgroundiftartagname spanreturn falsesinaads windowsinaads pushnfocusscrollspace 40 pxelem typetempobjcarselectreturn false sinaadssinahometabinswindowsinaadsregisterframeautologinsthn elsen forvarask2span trydocumentgetelementbyid sinahometabinsid nwraph wordvar maxvar tabadcontentobjaddeventlistenerevt funcdocumentcreateelementins var sinahometabsctextjavascript0l tabadpvlengthpdocumentgetelementbyidsichannelshowspan2styledisplaytimernone sinaadslide01prevstylebackgroundcoloritotal dimageslengthd0 lreturnn n0eduadspan2 0eduadspan3 0nsinahometabinsclassname sinaadseobj eobj eobjparamssinaadslide01itemstwostyledisplayvar cwindowsinaads push sinaadsevt funcff8400sfocusscrollspeedcnhk731lolsinaads windowsinaadsfocusscrollscrollcontidiftartagname span try15 focusscrollcircularlyfocusscrollnext return falseeventtype functype fnsinaadslide01itemsattacheventobj evt funcsinahometabscsolidregisterinfor registerinforp110 focusscrollspace10 focusscrollspace 40objaddeventlistenereventtypemathroundvhtabadcontentmin 0documentgetelementbyideventtarget eventsrcelementifobjaddeventlistener objaddeventlistenerevt funcgifarguments1n var tabadpvainputvtvar dfunctionneduadspan0 0eduadspan1crvelsen forvar psinaadslide01dots7n paramsnfocusscrollspeed 10 focusscrollspacesinaadsfocusscrolllistevent21objaddeventlistenereventtype functfboysid focusscrollframewidthfalse focusscrollspeedjoin spanidappendchildsinahometabins spanidappendchildsinahometabsc1nsinahometabinssetattributedataadpdpsfalse functionelement documentgetelementbyid sinahometabinsidtabadpvlengthp lpndocumentcreateelementins var0lsinahometabinsclassname sinaads sinahometabinssetattributedataadpdpsvar i 01n returnn nfunction elemreturn else varvar tarspanidappendchildsinahometabins spanidappendchildsinahometabscsinaadtoolkitsiologpageviewlinknlista livar eelement documentgetelementbyidsguidsiweiborecommendwrap listasinaads sinahometabinssetattributedataadpdpssuatrackindexnewpic ilovepicchangeredpoint catchefocusscrollnexturltextjavascript sinahometabsctext sinaadssuvmax objpagelength0 elsevoidevt1e50eduadspan2 0eduadspan3adedulistsinahometabinsid sinaadtab06numeventsrcelement iftartagnamelpn19a1focusscrollautoplaybpicshowmathrandomparamsn sinaadssuccesshandler functionpx focusscrollautoplay truesinahometabinsid nfocusscrolldotclassname classnamelistalpn var pageviewlinkobjattacheventon eventtype funcdcachecurvaltabadpvlengthp lpn varalengthfunction varreturnn n elsenfunctiona bparamsnsinaadslide01prevstylebackgroundcolordategettimefunction focusscrollpre returnp 0l tabadpvlengthpobjclassname numtar eventtarget eventsrcelementsinaadssuccesshandlerjfocusscrollnext returnn var tabadcontentshm callback functionvar pageviewlink tabadpvpnquotquotcharsetgbk16focusscrollframewidtheduadspan0 0eduadspan1 0eduadspan2islogin windowsinaoutloginlayerisloginfunction getrandomobjevt func functionfunc function getrandomobjthisstatus scrollingelsenfocusscrolldotonclassnamemathroundmathrandommax minfalse focusscrollspeed 10null function0 ifstwindowsinaads push varfalse else ifeobjattacheventsinahometabsctext sinaads windowsinaads1px1 acachecurindexfocusscrolllisttype number focusscrolllisteventpathscrollpicfunc eobjeventsrcelement13functionb varrandomnum mathroundmathrandommaxcallback function varelembcachekeydownoffcurclassnamefunctionn eduadspan0focusscrolldotclassnameid returndefaultifspanidgetelementsbytagnameinslength 0 returnelement26getrandomobj varfunctionobjwindowsinaads pushnhiddenfunction focusscrollnextvar pageviewlinkobjattacheventon evtnewfalse sinaadscatch e1n returnnsinahometabins documentcreateelementins var040 pxgetrandomobj var maxkeyarguments1nfocusscrollspeed 100 1forvar pspanidolinkseobjif 1e5block22try suatrackindexnewpicfunction iftabadcontentcontent0pvnname shmkiftartagnamepushpartt uniblkt ordermenumvinputfalse sinaads windowsinaadsmax objpagelength 1objattacheventon14objclassnamedinputvaluecurrenttagb var1leftliobjaddeventlistenerevt func falsepartt uniblktonmouseover focusscrollframewidthlqffunction focusscrollpreeventsinahometabsc documentcreateelementscriptifobjaddeventlistenerfnqvaluedatapageviewlink tabadpvpn sinaadtoolkitsiologpageviewlinknbt15 focusscrollcircularly truenameheightvar tabadcontent arguments1nspanidappendchildsinahometabscifspanidgetelementsbytagnameinslengthregisterinforreturn documentgetelementbyidid nullspanidappendchildsinahometabinsgpush varscrollingeobj ifobjaddeventlistenervar sinahometabins documentcreateelementinsjsloader namepartregisteritotalsuatrackindexnewpicdocumentgetelementbyidsiweiborecommendspanstyledisplayfunction nlfocusscrollcircularly trueelsen forvarvar tar eventtargetparamsn sinaadssuccesshandlertextjavascript sinahometabsctexttypevar focusscroll newcatchepx focusscrollautoplayfunction attacheventobjthismultfvar bwindowsinaads pushn elementobjattacheventon evt funcfunction var focusscrolllennull function attacheventobjsearchcars carselectifspanidgetelementsbytagnameinslength 0var min 0focusscrollautoplay truedocumentcreateelementscript sinahometabinsclassnamesinahometabsctext sinaadsfunction attacheventobj evtelem type fnvar sinahometabscobjpagelength 1 varobjaddeventlistenereventtype func false0 return elseacttry suatrackindexnewpic ilovepicchangeredpointfocusscrollupright false focusscrollspeedjsloader name shmsinaadslide01nextfocusscroll newfixsinaadtab0mathroundvh thismultarguments1n varsinahometabsctextfunctionaacachehotlistmod10hdimg23rnclassnamelastnumsinahometabsctype textjavascriptscriptpush sinaads windowsinaadscos425bvh2true focusscrollautoplaytimeask2r1 2mathroundmathrandommax0 varbhmin objpagetorandomnumguessurlvar randomnum mathroundmathrandommaxpush paramscaseobj eobjwindowsinaads push paramsfocusscrolllisttypepgaif fortabrandom58eventtypemathroundvh thismult 1settimeoutfunctionpostopattacheventobjfunc function0eduadspan1focusscrollinitializecallbackvoid 0ifobjaddeventlistener objaddeventlistenerevteobj eobjg htabadpvdocumentgetelementbyidid nullordermenuattacheventobj evtfocusscrollautoplaytime 15tabadpv tabadcontentcontent0pvnvar tabadpv tabadcontentcontent0pvnifeobjattachevent objattacheventonn n nfocusscrollprefocusscrollautoplaytimedocumentgetelementbyidid null functionfocusscrollcircularly true focusscrollinitializeshowifeobjattacheventreturnnid return documentgetelementbyididfocusscrollpre return falseoldscriptguesswraptarcatchuniblktpipobj1px solide4e4e40 var randomnum30 pxaselectc

Longtail Keyword Density for Sina.com.cn

KeywordsOccurences
sinaads windowsinaads push33
n n n16
jsloader name shm16
name shm callback15
callback function var15
shm callback function15
push sinaads windowsinaads10
windowsinaads push sinaads10
function focusscrollnext return7
function focusscrollpre return7
focusscrollcircularly true focusscrollinitialize7
focusscrollpre return false7
focusscrollnext return false7
focusscroll new scrollpic7
new scrollpic focusscrollscrollcontid7
var focusscroll new7
function var focusscroll6
focusscrollautoplay true focusscrollautoplaytime6
focusscrollupright false focusscrollspeed6
px focusscrollautoplay true6
focusscrollspace 40 px5
var i 05
15 focusscrollcircularly true5
siweiborecommendwrap list-a li5
focusscrollautoplaytime 15 focusscrollcircularly5
40 px focusscrollautoplay5
windowsinaads push var4
thismult 1 24
eventtype func else4
mathroundvh thismult 14
n join spanidappendchildsinahometabins4
tabadpvlengthp lpn var4
0l tabadpvlengthp lpn4
var pageviewlink tabadpvpn4
pageviewlink tabadpvpn sinaadtoolkitsiologpageviewlinkn4
n n join4
join spanidappendchildsinahometabins spanidappendchildsinahometabsc4
id return documentgetelementbyidid4
return false sinaads4
p 0l tabadpvlengthp4
false sinaads windowsinaads4
focusscrolldotclassname classname focusscrolldotonclassname4
number focusscrolllistevent onmouseover4
focusscrolllisttype number focusscrolllistevent4
false focusscrollspeed 104
focusscrollspeed 10 focusscrollspace4
function elem type4
focusscrolllistevent onmouseover focusscrollframewidth4
elem type fn4
10 focusscrollspace 404
true focusscrollautoplaytime 154
function id return4
lpn var pageviewlink4
sinahometabinsclassname sinaads sinahometabinssetattributedata-ad-pdps4
documentcreateelementscript sinahometabinsclassname sinaads4
forvar p 0l4
sinahometabsctype textjavascript sinahometabsctext4
textjavascript sinahometabsctext sinaads4
windowsinaads pushn element4
sinaads windowsinaads pushn4
sinahometabsctext sinaads windowsinaads4
var sinahometabsc documentcreateelementscript4
documentcreateelementins var sinahometabsc4
ifspanidgetelementsbytagnameinslength 0 return4
function var spanid4
windowsinaads push params4
0 return else4
return else var4
sinahometabins documentcreateelementins var4
var sinahometabins documentcreateelementins4
else var sinahometabins4
pushn element documentgetelementbyid4
sinahometabsc documentcreateelementscript sinahometabinsclassname4
var tabadpv tabadcontentcontent0pvn4
arguments1n var tabadpv4
tabadcontent arguments1n var4
0eduadspan2 0eduadspan3 0n4
1n returnn n4
element documentgetelementbyid sinahometabinsid4
n elsen forvar4
returnn n elsen4
var tabadcontent arguments1n4
elsen forvar p4
sinahometabinsid n paramsn4
documentgetelementbyid sinahometabinsid n4
n var tabadcontent4
paramsn sinaadssuccesshandler function4
n paramsn sinaadssuccesshandler4
sinaadssuccesshandler function n4
function n var4
var min 03
min 0 var3
var randomnum mathroundmathrandommax3
0 var randomnum3
1 var min3
var max objpagelength3
function getrandomobj var3
getrandomobj var max3
randomnum mathroundmathrandommax min3
max objpagelength 13
objpagelength 1 var3
eventtarget eventsrcelement iftartagname3
try suatrackindexnewpic ilovepicchangeredpoint3
suatrackindexnewpic ilovepicchangeredpoint catche3
func function getrandomobj3
part-t uni-blk-t order-menu3
span try suatrackindexnewpic3
iftartagname span try3
min min objpagetorandomnum3
var tar eventtarget3
tar eventtarget eventsrcelement3
eventsrcelement iftartagname span3
mathroundmathrandommax min min3
objaddeventlistenereventtype func false3
null function attacheventobj3
documentgetelementbyidid null function3
function attacheventobj evt3
attacheventobj evt func3
evt func eobj3
return documentgetelementbyidid null3
functiona b var3
tabadpv tabadcontentcontent0pvn eduadspan03
eduadspan0 0eduadspan1 0eduadspan23
objattacheventon eventtype func3
func else objaddeventlistenereventtype3
else objaddeventlistenereventtype func3
func eobj eobj3
eobj eobj eobj3
false else ifeobjattachevent3
func false else3
else ifeobjattachevent objattacheventon3
ifeobjattachevent objattacheventon evt3
objattacheventon evt func3
objaddeventlistenerevt func false3
ifobjaddeventlistener objaddeventlistenerevt func3
eobj eobj obj3
eobj obj eobj3
obj eobj ifobjaddeventlistener3
eobj ifobjaddeventlistener objaddeventlistenerevt3
evt func function3
sinaads windowsinaads38
windowsinaads push36
function var30
return false30
jsloader name22
n n20
callback function20
name shm16
shm callback15
new scrollpic11
push sinaads10
0 09
eventtype func8
var c8
function focusscrollpre7
focusscroll new7
var focusscroll7
focusscrollpre return7
true focusscrollinitialize7
focusscrollcircularly true7
focusscrollnext return7
px focusscrollautoplay7
func false7
scrollpic focusscrollscrollcontid7
function focusscrollnext7
evt func6
type fn6
focusscrollupright false6
eobj eobj6
false focusscrollspeed6
0eduadspan3 0n6
siweiborecommendwrap list-a6
functiona b6
true focusscrollautoplaytime6
focusscrollautoplay true6
40 px6
catch e5
15 focusscrollcircularly5
focusscrollautoplaytime 155
var b5
sinaadssuccesshandler function5
focusscrollspace 405
false else5
eduadspan0 0eduadspan15
searchcars car-select5
false function5
return documentgetelementbyidid5
register-info-r register-info-r-p15
list-a li5
0eduadspan2 0eduadspan35
id return4
function id4
var d4
function e4
elem type4
charsetgbk url4
functiona var4
c path4
function elem4
var e4
id focusscrolldotlistid4
10 focusscrollspace4
focusscrollspeed 104
onmouseover focusscrollframewidth4
focusscrolllistevent onmouseover4
1 var4
push var4
push params4
1 24
thismult 14
mathroundvh thismult4
number focusscrolllistevent4
focusscrolllisttype number4
30 px4
1px solid4
0 14
h word4
false sinaads4
function if4
classname focusscrolldotonclassname4
focusscrolldotclassname classname4
func else4
0 else4
mouseover function4
element documentgetelementbyid4
documentgetelementbyid sinahometabinsid4
pushn element4
windowsinaads pushn4
textjavascript sinahometabsctext4
sinahometabsctext sinaads4
sinahometabinsid n4
n paramsn4
tabadcontent arguments1n4
arguments1n var4
var tabadcontent4
n var4
paramsn sinaadssuccesshandler4
function n4
sinahometabsctype textjavascript4
sinahometabinsid sinaadtab04
0 return4
return else4
ifspanidgetelementsbytagnameinslength 04
var spanid4
ask-2 ask-2-r4
0 var4
else var4
var sinahometabins4
sinahometabinsclassname sinaads4
sinaads sinahometabinssetattributedata-ad-pdps4
documentcreateelementscript sinahometabinsclassname4
sinahometabsc documentcreateelementscript4
sinahometabins documentcreateelementins4
documentcreateelementins var4
var tabadpv4
var sinahometabsc4
tabadpvlengthp lpn4
0l tabadpvlengthp4
join spanidappendchildsinahometabins4
forvar p4
lpn var4
var pageviewlink4
spanidappendchildsinahometabins spanidappendchildsinahometabsc4
n join4
tabadpvpn sinaadtoolkitsiologpageviewlinkn4
pageviewlink tabadpvpn4
elsen forvar4
p 0l4
returnn n4
1n returnn4
n elsen4
tabadpv tabadcontentcontent0pvn4
iftartagname span3
min 03
var min3
try suatrackindexnewpic3
span try3
var randomnum3
mathroundmathrandommax min3
min min3
min objpagetorandomnum3
var tar3
tar eventtarget3
eventsrcelement iftartagname3
eventtarget eventsrcelement3
randomnum mathroundmathrandommax3
part-t uni-blk-t3
objattacheventon eventtype3
thisstatus scrolling3
0 if3
0eduadspan1 0eduadspan23
objaddeventlistenereventtype func3
id focusscrollframewidth3
arraysinaads windowsinaads3
itotal dimageslength3
islogin windowsinaoutloginlayerislogin3
functionn eduadspan03
ilovepicchangeredpoint catche3
none sinaadslide01prevstylebackgroundcolor3
tabadcontentcontent0pvn eduadspan03
if fortabrandom3
uni-blk-t order-menu3
suatrackindexnewpic ilovepicchangeredpoint3
else ifeobjattachevent3
function return3
objclassname num3
mod lqf3
else objaddeventlistenereventtype3
null function3
documentgetelementbyidid null3
url url3
functionb var3
if 1e53
g h3
searchcars search-type3
-1 acachecurindex3
void 03
b var3
function attacheventobj3
attacheventobj evt3
func function3
objattacheventon evt3
function getrandomobj3
getrandomobj var3
max objpagelength3
var max3
ifeobjattachevent objattacheventon3
0 l3
eobj obj3
func eobj3
obj eobj3
eobj ifobjaddeventlistener3
objaddeventlistenerevt func3
ifobjaddeventlistener objaddeventlistenerevt3
objpagelength 13
var179
function118
089
return59
false55
windowsinaads43
sinaads42
142
n41
if40
c39
push37
else31
e29
b27
d25
callback24
new24
true23
url23
none23
jsloader23
name22
func21
220
id19
l18
317
shm16
searchcars16
415
null15
514
functiona13
613
713
h13
eobj12
812
912
try12
p11
eventtype11
1011
scrollpic11
1111
1210
px10
min10
type10
block10
solid10
ff84009
139
f9
list-a8
t8
sinahometabinsid8
k8
148
li8
s8
params8
0n8
register-info-r8
fn8
vr8
g8
path8
register-info-r-p18
j7
evt7
eduadspan07
focusscrollautoplaytime7
focusscrollautoplay7
focusscrollcircularly7
focusscrollinitialize7
vt7
focusscrollspace7
focusscrollspeed7
focusscrollscrollcontid7
focusscrollframewidth7
focusscrollpagewidth7
focusscrollupright7
left7
hidden7
focusscrollnext7
0eduadspan27
0eduadspan37
focusscrollpre7
mod-djjp7
focusscroll7
catche7
key7
siweiborecommendwrap6
156
objattacheventon6
links6
len6
166
acachecurindex6
functionb6
lastnum6
onmouseover6
num6
ask-26
forvar6
tempobj6
postop6
mouseover6
documentgetelementbyidid6
176
number5
185
classname5
part-register5
obj5
o5
pipobj5
span5
typeof5
charsetgbk5
fun5
car-select5
input5
pb5
195
settimeoutfunction5
background5
suv5
catch5
0eduadspan15
sinaadssuccesshandler5
documentcreateelementscript5
textjavascript5
tfboys5
cache4
dinputvalue4
undefined4
alength4
dmaxlen4
word4
focusscrolllisttype4
case4
focusscrolllistevent4
event4
sinahometabsctype4
fnqvalue4
sinahometabsctext4
width4
bkeycode4
sina4
act4
sinahometabinssetattributedata-ad-pdps4
sinaadtab04
204
sinahometabinsclassname4
sinahometabins4
sinaadslide01itemstwostyledisplay4
focusscrolldotclassname4
documentcreateelementins4
ifspanidgetelementsbytagnameinslength4
spanid4
quotquot4
focusscrolldotlistid4
sinaadslide01itemsonestyledisplay4
document4
list-b4
part-t4
registerframeautologinsth4
1px4
imgs4
formsetattributeaction4
registerframeautol4
ask-2-r4
sinahometabsc4
focusscrolldotonclassname4
mod-10-hdimg4
pga4
formsubmit4
gif4
while4
join4
etarget4
spanidappendchildsinahometabins4
elem4
sinaadtoolkitsiologpageviewlinkn4
lpn4
pushn4
bpicshow4
tabadpvpn4
spanidappendchildsinahometabsc4
214
thismult4
vb4
fortabrandom4
nhk7314
224
234
sguid4
data4
dategettime4
mathroundvh4
currenttag4
pageviewlink4
tabadcontent4
1n4
documentgetelementbyid4
tabadpvlengthp4
functionn4
tabadpv4
tabadcontentcontent0pvn4
mathrandom4
margin-left4
fix4
returnn4
elsen4
0l4
arguments1n4
top4
paramsn4
default4
element4
cos3
eventsrcelement3
sinaadslide01items3
eventtarget3
iftartagname3
suatrackindexnewpic3
guessurl3
243
st3
ilovepicchangeredpoint3
sinaadslide01dots3
lol3
script3
dimageslength3
itotal3
bvh3
bt3
functionobj3
thisstatus3
arraysinaads3
ratehq3
show3
scrolling3
timer3
bh3
uni-blk-t3
sinaadslide01nextstylebackgroundcolor3
sinaadslide01prevstylebackgroundcolor3
sinaadslide01next3
order-menu3
12px3
tar3
windowsinaoutloginlayerislogin3
islogin3
e4e4e43
search-type3
aselectc3
asendrequest3
daddf3
amaxlen3
oldscript3
ainput3
void3
acachehotlist3
dcachecuritem3
dcachecurval3
bcachekeydownoff3
bsugwrapstyledisplay3
acurmaxlen3
hot3
lqf3
documentgetelementbyidsiweiborecommendspanstyledisplay3
253
documentgetelementbyidsichannelshowspanstyledisplay3
objaddeventlistenereventtype3
documentgetelementbyidsichannelshowspan2styledisplay3
mousedown3
263
a13
mod3
wrap3
string3
utf-83
1e53
rn3
center3
ifobjaddeventlistener3
attacheventobj3
adedulist3
imggetattributedata-src3
curclassname3
objaddeventlistenerevt3
ifeobjattachevent3
randomnum3
mathroundmathrandommax3
objpagelength3
max3
getrandomobj3
guesswrap3
no-repeat3
mv3
mod-103
line-height3
height3
gpush3
height25px3
23px3
273
objclassname3
cr-v3
-2px3
283
objpagetorandomnum3

What are the nameservers for sina.com.cn?

Sina.com.cn Domain Nameserver Information

HostIP AddressCountry
ns3.sina.com.cn 123.125.29.99China China
ns2.sina.com.cn 61.172.201.254China China
ns4.sina.com.cn 121.14.1.22China China
ns1.sina.com.cn 202.106.184.166China China

Sina.com.cn Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Sina.com.cn is a scam?