|  Autovermietung: Mietwagen günstig online buchen | Sixt 
Low trust score  | 
Sixt Autovermietung: Die Nummer 1 in Deutschland✔ Über 4.000 Mietwagen-Stationen weltweit✔ PKW✔ LKW✔ Direkt online buchen & sparen✔ Website Information

Website Ranks & Scores for

Statvoo Rank Statvoo Rank:D
Alexa Rank Alexa Rank:35,836
Majestic Rank Majestic Rank:55,243
Domain Authority Domain Authority:73%
DMOZ DMOZ Listing:No

Whois information for

Full Whois Lookup for Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

% Copyright (c) 2010 by DENIC
% Version: 2.0
% Restricted rights.
% Terms and Conditions of Use
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:

Status: connect
Changed: 2013-12-10T10:44:25+01:00

Name: InterNetX GmbH
Organisation: InterNetX GmbH
Address: Maximilianstrasse 6
PostalCode: 93053
City: Regensburg
CountryCode: DE
Phone: +49-941-59559482
Fax: +49-941-59579050
Email: Login to show email

Name: InterNetX GmbH
Organisation: InterNetX GmbH
Address: Maximilianstrasse 6
PostalCode: 93053
City: Regensburg
CountryCode: DE
Phone: +49-941-59559482
Fax: +49-941-59579050
Email: Login to show email

Who hosts is hosted by SOPRADO GmbH in Bayern, Neugruenwald, Germany, 82031. has an IP Address of and a hostname of and runs myracloud web server. Web Server Information

Hosted IP Address:
Service Provider:SOPRADO GmbH
Hosted Country:GermanyDE
Location Latitude:48.0503
Location Longitude:11.5333
Webserver Software:myracloud
Google Map of 50,12

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: myracloud
Date: Sat, 13 Jun 2015 15:27:21 GMT
Content-Type: text/html; charset=ISO-8859-15
Transfer-Encoding: chunked
Connection: keep-alive
P3P: policyref='http://(null)/w3c/p3p.xml',CP='NON DSP COR CURa ADMa DEVa TAIa OUR BUS IND PHY ONL UNI PUR COM NAV DEM'
Content-Encoding: gzip
vary: accept-encoding
Expires: Sat, 13 Jun 2015 15:27:21 GMT
Cache-Control: max-age=0
ETag: myra-2d42f32

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

slp63bietencheckinjetzt kostenloswhlen sie24hangebotenoch schnellerffnungszeitenmietwagensie noch schnellersterreichmit der sixtobdiesichschneller mitoptfalse varunserzustellungauthorsixt service24h auf anfragestandortsuchehttpsmit derappvergessenmobilfunkpreis maxbuchenzumpartnerlabelumvarautokoumlnnen siebenutzernameleiderlandauf anfragesie auchwhlenfestnetzpreisrent a carauto mietenjetztstationenverfgbarhabencookienamesethomeweiterweltweitmobilfunkpreisistlangschnellerkostenlos imanfragebuchen sie nochtruemaxratesonntag24h aufbei sixtkeineautovermietungvor2sinddienstagbittemittwochrckgabe 24hbeliebtemontagthemalkwaltrusslandwoihreeinwegmieteonline checkinfuumlreinappstore downloadenim appstore downloadenmietenvon24h mglichim appstoreihnenuumlberctanrufleihwagenaufsxrestxtkostenlosbeliebte sixtdasseuropawirvalfalsefreitagdasihremrckgabevor ortkostenlos im appstoreschweizberlinampauch imsixtstationenihrerdernoch schneller mitkoumlnnenangebotservicebuchen sielabel val optsdownloadenunswieoderauchappstoredonnerstagsamstagortdemnochimsie nochrentsixt appabholung rckgabenichtsouhrflagdeutschlandeinenval optcarsie dieeinemitloginder sixtallefindenihren0label valabholungstsixt mietwagenrepubliksiejetzt kostenlos imctminsie sichihresonlinefunctionschneller mit derstringsixtmglichadressedencasezuflughafenifdateunsereuumlberallpreissixt rent1beilaumlnderweitereamnbspfuumlr diewennalternative

Longtail Keyword Density for

schneller mit der5
noch schneller mit5
mit der sixt5
buchen sie noch5
sie noch schneller5
jetzt kostenlos im4
rent a car3
label val opt3
im appstore downloaden3
kostenlos im appstore3
24h auf anfrage3
der sixt8
vor ort6
buchen sie5
sie noch5
schneller mit5
mit der5
jetzt kostenlos5
noch schneller5
false var5
koumlnnen sie4
sie sich4
sie auch4
sixt service4
label val4
bei sixt4
kostenlos im4
whlen sie4
rckgabe 24h4
mobilfunkpreis max4
sixt app3
fuumlr die3
sixt mietwagen3
beliebte sixt3
auch im3
24h mglich3
sixt rent3
auto mieten3
online checkin3
appstore downloaden3
im appstore3
auf anfrage3
sie die3
val opt3
24h auf3
abholung rckgabe3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry Germany Germany Germany DNS Record Analysis DNS Lookup

Serial: 2015052801
Refresh: 7200
Retry: 3600
Expire: 604800
sixt.deTXT14400TXT: v=spf1
ip4: ip4:
ip4: -all

Alexa Traffic Rank for

Alexa Search Engine Traffic for