Sixt.de Website Analysis Summary

Sixt.de  |  Sixt Autovermietung: Die Nummer 1 in Deutschland✔ Über 4.000 Mietwagen-Stationen weltweit✔ PKW✔ LKW✔ Direkt online buchen & sparen✔
Low trust score  | 
Autovermietung: Jetzt gnstig Auto mieten bei Sixt


Rank
315,495
Rating
F
Trust Score
Low Trust Score
Estimated worth
$29,700
Estimated daily income
$55
Estimated monthly income
$1,673
Backlinks
0

Sixt.de has a Low Trust Score, and a Statvoo Rank of F.

Sixt.de is hosted by SOPRADO GmbH in Bayern, Neugruenwald, Germany, 82031.
Sixt.de has an IP Address of 91.236.122.20 and a hostname of x5bec7a14.host.myracloud.com and runs myracloud web server.

The domain sixt.de was registered 201 decades 9 years 3 months ago by , it was last modified 5 years 1 month 13 hours ago and currently is set to expire 201 decades 9 years 3 months ago.

It is the world's 315,495 most popular site among over 300 million websites.

Sixt.de has a total of 0 backlinks.

Sixt.de gets approximately 4,881 unique visitors a day and 19,524 pageviews per day.

Sixt.de has an estimated worth of $29,700.
An average daily income of approximately $55, which is wroughly $1,673 per month.

Whois information for sixt.de

Full Whois Lookup for Sixt.de Whois Lookup

% Copyright (c) 2010 by DENIC
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%

Domain: sixt.de
Nserver: b.ns14.net
Nserver: c.ns14.net
Nserver: d.ns14.net
Status: connect
Changed: 2013-12-10T10:44:25+01:00

[Tech-C]
Type: PERSON
Name: InterNetX GmbH
Organisation: InterNetX GmbH
Address: Maximilianstrasse 6
PostalCode: 93053
City: Regensburg
CountryCode: DE
Phone: +49-941-59559482
Fax: +49-941-59579050
Email: Login to show email
2016-08-08T10:16:59+02:00

[Zone-C]
Type: PERSON
Name: InterNetX GmbH
Organisation: InterNetX GmbH
Address: Maximilianstrasse 6
PostalCode: 93053
City: Regensburg
CountryCode: DE
Phone: +49-941-59559482
Fax: +49-941-59579050
Email: Login to show email
2016-08-08T10:16:59+02:00

Who hosts Sixt.de?

Sixt.de Web Server Information

Hosted IP Address:91.236.122.20
Hosted Hostname:x5bec7a14.host.myracloud.com
Service Provider:SOPRADO GmbH
Hosted Country:GermanyDE
Location Latitude:48.0503
Location Longitude:11.5333
Webserver Software:myracloud

HTTP Header Analysis for Sixt.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: myracloud
Date: Sat, 13 Jun 2015 15:27:21 GMT
Content-Type: text/html; charset=ISO-8859-15
Transfer-Encoding: chunked
Connection: keep-alive
P3P: policyref='http://(null)/w3c/p3p.xml',CP='NON DSP COR CURa ADMa DEVa TAIa OUR BUS IND PHY ONL UNI PUR COM NAV DEM'
Content-Encoding: gzip
vary: accept-encoding
Expires: Sat, 13 Jun 2015 15:27:21 GMT
Cache-Control: max-age=0
ETag: myra-2d42f32

Need to find out who hosts Sixt.de?

Sixt.de Free SEO Report

Website Inpage Analysis for Sixt.de

H1 Headings:1
Autovermietung Sixt: In 105 Ländern weltweit Auto mieten.
H2 Headings:5
Auto mieten bei der Sixt Autovermietung
Standorte der Sixt Autovermietung in Deutschland
Sixt app laden
Leihwagen in Europa & weltweit an über 2.200 Stationen der Sixt Autovermietung
Alle Sixt Service Leistungen
H3 Headings:8
Ihre Vorteile bei Sixt rent a car
Sixt Flughafen Stationen in Deutschland
Regine Sixt Kinderhilfe Stiftung
Sixt Rent a Car Webseiten International
Europaweit Auto leihen und den Sixt Service geniessen
Sixt car rental in Europa
Sixt car rental weltweit
Mietwagen Kategorien
H4 Headings:7
Beliebte Stationen für Auto Rental in Europa & Weltweit
Extras
Zeitdauer
Top Angebote
Stationen
Anlässe
Infos
H5 Headings:6
Mobil buchen
Fahrzeuge mieten
Fahrzeugmodelle
Stationssuche
Umzugsservice
Mietservice
H6 Headings:0
Total IFRAMEs:1
Total Images:12
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Sixt.de

beliebteoptdaswhlen24h auf anfragecarmglichbeliebte sixtwodonnerstagleidervorbuchen sieeinewiedemlabel valuumlberallrent a cardervergessenschneller mit der0themaappstoreautoabholungssamstagberlinval optkoumlnnenaufonline checkinvardienstagihremsixtihrerfalse varsie nochweltweitangebotsonntagbenutzernamecaseflagsie noch schnellersixtstationensie sichmit dersxrestxtlabel val optsie diesixt renttruestringcheckinfalseoderffnungszeitenwhlen sieihremobilfunkpreisonlinecookienameauto mietensixt mietwagenmittwochamfuumlr diefunctionloginrepublikvonsouhrsielabelrusslandrckgabeort2unsereauchmit der sixtdiesindzukostenlos imdenappstore downloadenalternativenoch schnellerrentkostenlosihressichim appstore downloadenschnellernichtiffreitagsie auchistlangrateunsernoch schneller mitwirmaxschweizzustellungfestnetzpreissixt appdateampbuchen sie nochmietenautovermietunglkwuumlberpreisservicerckgabe 24hhaben1dasseuropasterreichctminfindenwennhttpskoumlnnen sie24h mglichmietwagenlandihnenbuchenverfgbarmobilfunkpreis maxweiterabholung rckgabelaumlnderctanrufumbei sixtauch imanfragemontagkostenlos im appstoreallehomeappobauthorvor ortbietenfuumlrdownloadenstandortsuchekeinemitleihwageneinangeboteflughafenpartnerjetzt kostenlos imstationender sixtadressevalbeiihrenauf anfragejetztim appstoredeutschland24h aufaltjetzt kostenlosnbsp24heinwegmietestnochweiterezumslp63imeinenunssixt servicesetbitteschneller mit

Longtail Keyword Density for Sixt.de

KeywordsOccurences
schneller mit der5
noch schneller mit5
mit der sixt5
buchen sie noch5
sie noch schneller5
jetzt kostenlos im4
rent a car3
label val opt3
im appstore downloaden3
kostenlos im appstore3
24h auf anfrage3
der sixt8
vor ort6
buchen sie5
sie noch5
schneller mit5
mit der5
jetzt kostenlos5
noch schneller5
false var5
koumlnnen sie4
sie sich4
sie auch4
sixt service4
label val4
bei sixt4
kostenlos im4
whlen sie4
rckgabe 24h4
mobilfunkpreis max4
sixt app3
fuumlr die3
sixt mietwagen3
beliebte sixt3
auch im3
24h mglich3
sixt rent3
auto mieten3
online checkin3
appstore downloaden3
im appstore3
auf anfrage3
sie die3
val opt3
24h auf3
abholung rckgabe3
mietwagen59
var53
sie48
sixt40
flughafen37
die29
false23
wir17
der17
oder16
mit15
zu13
im12
auch12
auf12
fuumlr11
den10
stationen10
ist10
bitte10
abholung9
mieten9
deutschland8
nicht8
ein8
um8
zum8
koumlnnen8
function8
sich8
noch7
sind7
so7
label7
rckgabe7
uhr7
ort7
montag7
einen7
das7
login7
whlen7
bei7
s7
service7
ihnen7
vor6
val6
24h6
ihre6
buchen6
true6
haben6
eine6
zustellung5
app5
leihwagen5
europa5
downloaden5
kostenlos5
sixt-stationen5
schneller5
jetzt5
auto5
donnerstag5
opt5
angebot5
if5
05
republik5
ihren4
online4
weiter4
wo4
st4
unser4
schweiz4
adresse4
nbsp4
alt4
weltweit4
14
von4
unsere4
dienstag4
freitag4
samstag4
bieten4
max4
mobilfunkpreis4
finden4
string4
wie4
ctmin4
autovermietung4
ctanruf4
am4
standortsuche4
home4
mglich4
dass3
ihrer3
berlin3
uns3
thema3
beliebte3
lang3
uumlber3
ob3
laumlnder3
uumlberall3
23
einwegmiete3
car3
rent3
anfrage3
leider3
benutzername3
weitere3
verfgbar3
keine3
mittwoch3
festnetzpreis3
ffnungszeiten3
land3
sxrestxt3
lkw3
wenn3
cookiename3
preis3
partner3
case3
flag3
sonntag3
rate3
dem3
sterreich3
alternative3
russland3
amp3
set3
alle3
ihres3
date3
vergessen3
angebote3
ihrem3
appstore3
slp-633
author3
checkin3
https3

What are the nameservers for sixt.de?

Sixt.de Domain Nameserver Information

HostIP AddressCountry
UnknownUnknownUnknownUnknown