Website Analysis Summary  |  Skatteverket - Vår vision är ett samhälle där alla vill göra rätt för sig
Low trust score  | 
Startsida | Skatteverket

Trust Score
Low Trust Score
Estimated worth
Estimated daily income
Estimated monthly income
0 has a Low Trust Score, and a Statvoo Rank of C. is hosted by Swedish Tax Agency in Stockholms Lan, Solna, Sweden, 17331. has an IP Address of and a hostname of and runs Apache-Coyote/1.1 web server.

The domain was registered 1 decade 5 years 6 months ago by NIC-SE, it was last modified 201 decades 9 years 4 months ago and currently is set to expire 3 years 6 months 4 weeks ago.

It is the world's 18,034 most popular site among over 300 million websites. has a total of 0 backlinks. gets approximately 97,593 unique visitors a day and 585,558 pageviews per day. has an estimated worth of $843,120.
An average daily income of approximately $1,171, which is wroughly $35,618 per month.

Whois information for

Full Whois Lookup for Whois Lookup

# Copyright (c) 1997- IIS (The Internet Foundation In Sweden).
# All rights reserved.
# The information obtained through searches, or otherwise, is protected
# by the Swedish Copyright Act (1960:729) and international conventions.
# It is also subject to database protection according to the Swedish
# Copyright Act.
# Any use of this material to target advertising or
# similar activities is forbidden and will be prosecuted.
# If any of the information below is transferred to a third
# party, it must be done in its entirety. This server must
# not be used as a backend for a search engine.
# Result of search for registered domain names under
# the .se top level domain.
# This whois printout is printed with UTF-8 encoding.
state: active
holder: skatte0702-00021
admin-c: skatte0702-00021
tech-c: skatte0702-00027
tech-c: skatte0702-00028
billing-c: skatte0702-00029
created: 2004-07-21
modified: 2017-07-31
expires: 2018-07-21
dnssec: signed delegation
status: ok
registrar: SE Direkt

Who hosts Web Server Information

Hosted IP Address:
Service Provider:Swedish Tax Agency
Hosted Country:SwedenSE
Location Latitude:59.36
Location Longitude:18.0009
Webserver Software:Apache-Coyote/1.1

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 10 Jun 2015 11:59:09 GMT
Server: Apache-Coyote/1.1
X-UA-Compatible: IE=EDGE
Cache-Control: no-cache
Pragma: no-cache
Expires: Tue, 01 Jan 1980 12:01:01 GMT
Content-Type: text/html;charset=UTF-8
Content-Encoding: gzip
Vary: Accept-Encoding
Connection: close

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:1
H2 Headings:11
Skattetabeller 2020
Ansök om id-kort
Beställ personbevis
Alla e-tjänster
Kontakta oss
Hitta snabbt
Viktiga datum för privatpersoner
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:5
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

mer omersttningsjlv du flyttarchange of addressp pantsttning avdecember 2016p arbetevaror frnviktiga datumlnderapplyingmarriagemerlistsociallinks ul lidemandgaranti exempelunderimportant eservicefastighetsskattvanliga frgorbytafrgor omul lirutarbeterelativeoch skatteavdragyourself youvid importtextdecoration10kostnadsersttningskabostadsrttinkpyou are movingfrn andra eulnders fungerardeklarerar duelserot och rutavdragmed mera122017 eller senareuppskovfyller duskattereduktion frflyttar med dinhandelsbolagskattefria frmneroch fastighetsskattkostnader2013 2012sljaviktigajuridiskajustering avav varoradressifjquerythishasclassactive countplistsociallinks ulossskyldighet attutbildningskatt atttransportmedelfontstyle normaldittnsverigeinvesteraravdragoch rutarbetesidorskatteuppskovsld 21till andra eulndernonearbetaskatteverketskontaktahravsndares skerhetrutmessagesimportantktenskapsregistretdeklarerarmmskatt p arbetecartevillkor fr attstartainternationelltillgngarsanssamfllighetsfreninglieller senareoch marknadshandelav skattbusinessestorgenergiskattinkomstretrersttningarenergiskatt p elsenarejanuari 2017 eller16pxahovervara nrstende tillteknisk informationfontsize 16pxp demandgaranti exempeltill lnder utanfrejemcs inte ratt tnka pnrstende tillredovisningvatbusinesstavarumottagareyourinformationtypkoderavdrag frlineheightkontakta ossrot och rutarbeteeservicekontostdlgre skattbarnkodervrdeomrdenrealpropertyettmed dinfretagareinkomstermarknadshandelflytta undersompreliminr skatttextdecoration underlinehar dubeskrivningarbokfringersttning tilldeklareratdirektallarotsld 1 januaripaddingforeign entrepreneursavvecklalagerhllarefr lnunder skatteuppskov emcseesstatementsta emotdeklarationenbetalning avtrafikvanliga frgor omregistreraforeignln ldre2015 2014 2013bostad sld senastberknauppskov bostad2016 2015 2014frabsoluteexempel p pantsttningsaleslistfooterlinkssamordningsnummervaror och tjnsterfamilj duochopen sans semiboldarialsansserifsansserifposition absolute leftdirekt tillska betalaefternamncash registerupplagshavares skerhetfrn lnder utanfromvndvarorarkivfr arbeteattnyamed din familjupplagshavares flyttningsskerhet exempellnder utanfrdigitalkontrolluppgift2017 ellerinformation kontakta osscardom webbplatsenyouurfontweightfyllermm exempelelegitimationmina sidorinte varavarfysiska personersatt fmobilt bankiduleservice messagesvinsttidigaredebiterad preliminrskatt13personuppgifterndradeexport emcs vidinbetalningfr ln ldretnkaredovisning avkapitalfrskringfmansfretaglagring mmuppskov bostad sldskattereglerpantsttning avbosatt utomlandskontrolluppgifternrstendevaratillgng tillybestll2debiteradsaleln ldre beskrivningarav nringsverksamhet2012 2011marginpaymentfreskyldighet2014 2013 2012torg och168dc4kpsregistrerad avsndare registreradproblemarbeteyour familyom ossemcs tillgngfr inte vararttaarbetsgivaravgifter ochskattdu flyttar medfamilylistsociallinksansk omswedenflyttaskatternaexport emcsln fr ln7belongvara nrstende11omrdevrdeomrden beskrivningarenskildenergiskatterbofartyg preliminr skattbetalningsvarskerhet exempel pbokfringsskyldighetskickastd vidskatt plnder utanfr euemcs tillgng till2016 bostadfontweight normaleulnderbelopp6aactivefastighetsverige filmeruthyrningbankidutlndskt fartygavslutasjukvrdregistrerad avsndaresposition relativepersonalliggaretaxeringsvrdetemcs omhistoriafiberfreningvarumottagares skerhet exempelrttbostad sld 1positiongodknddecember 2016 bostadoktafretag och arbetedu flyttartjnstervaror ochimportexempel p demandgarantisjinkomstatt tnkabilincome taxvid utlandsarbetetillflligt registrerad varumottagareatt lmnaimport ta emotredovisarot ocheueesbouppteckningunder skatteuppskovinternationellareturn2014 2013tjnster frnupplagshavares skerhet frtill digskvnummer omrdeutanfrtax returnprocentcolorr tillgngligtvid export emcsidkortdemandgaranti1 januari 2017flyttar sjlv dutaxesfilmerfamily youfretagenergiskatt prknaestoppropagationregistrerademcsliststyle nonepensionsfrskringvissa5tnka pinom eundrajuni 2016 bostadexempel pstuderaaddressideellinkomst av nringsverksamhetfontfamily openhar rttimportant eservice messagestillgngligtregionencountrydigital brevldabosattaavett fretaginkomstskattyourselfdubbelbeskattningregistrerad varumottagarefolkbokfring15resoroch tjnstersjlvrttelse avsmhus1din familj dutaxflyttningsskerhet exempelslja tjnsterrutarbetenanvndersvenskadatumguideskatterprivatbostadtillflligt registreradantalannatp pantsttning20 juniflyttar sjlvavrkningeuanotheraktiebolagflyttningsskerhetavisitedvarumottagaressom lagerhllareemotfrnskatteverketelse ifjquerythishasclassactiveterbetalningoptionsutlandetkpainte vara nrstendesldmobilemenuopensprrat konto upplagshavaressjlvservice14kontaktpersoneraktierpantsttning av sprratcitizen1 januarivimedutlandsarbetepadding 0freningellerregistrerad varumottagareskortaredu flyttar sjlvjustering frfiberfrening somnormalfloatundantagln frpartnershipfr lagring mmworkzagranicznesans semiboldarialsansserifsansserifupphandlinggarlgenhetskatteuppskov emcssprrat kontocountskvnummerunderskottoch f tillbakafamiljnr duutlndskdecemberbetalakravpunktskattermellanvem skaskattereduktionflyttarliststyleintetillbakavanligareglertoptillgngligt tekniskimport tapayingdrivaemcs vid exportflyttar medlmnasnringsverksamhetvrdeomrden beskrivningar ln4utomlandsmyndigheteraqoonsigacount 3avkastningsskattworking in swedenmm exempel presor ochutomlands bosattasld 21 juni312016 bostad sldlistfooterlinks ahovercontentutlndsktdigskattesatservadbostad sldskatternaswpreliminrskattemcs vidfastighetstaxeringvarumottagares skerhetoch rutavdragexportavslutanskanmarginrightincomeregistrerad varumottagares skerhetom emcstekniskbetalasskogskontoskattedeklarationavdrag0 paddingldre beskrivningarbostadsrttsfreningarrkna ututlndskaansk2016 2015har deklareratnyhetersjlvrttelserntaflyttningsskerhet exempel pjuni31 decemberanmlafontfamily open sansahblanketter broschyrerideell freningpreliminr skatt jmkningbroschyreravgifterslutskattebeskeddufungerarkpa tjnster frnbilarutbetalningminatillflligtdu harsjlvnyheter 1deklarationskogsmarkbostadmargin 0 paddingblanketterombud fr ettdidentitlevnadskostnaderarbetsgivaravgifter och skatteavdragfr lagringdu skafrn utlndskasocialavgifterbeskrivningar ln frwebbplatsenifjquerythishasclassactiveworkingdriva fiberfreningskerhet exempellgrefastighetsavgiftlmna arbetsgivardeklarationjanuariterbetalning avgodknd lagerhllareidkortetfrmnernyemcs intetill lnderdeninte r tillgngligtav utlndsksld 1betala skattreportingp justeringleftflytta under skatteuppskovskattekontotbetala och fbestllajuniintkterdistansfrsljningfreningarinkomstupplagshavareaalla etjnsterarbetsgivaravgifter21 juni31semiboldarialsansserifsansserifenskild nringsverksamhetvemfr ett fretagdin familjfontfamilydethjlpatt betalakaprivatpersondinfontsizefstudenthurutanfr euinfrseltill andrabrevldalmnakassaregisterr tillgngligt teknisklnentrepreneursifsverige dutextdecoration nonespeljusteringtillgngligt teknisk informationdisplayfrn andra0 padding 0changeprivatskatteterbring0frsljningcashoch arbete8carte didentitjmkningoch svarregistrerad avsndares skerhetlistfooterlinks uldemandgaranti exempel plagring25pxopartnerskapinkomst avinte rfordonsskattfrsljning avjagfr att fskatteavdragavsndares skerhet exempelav sprratp utlndsktdriva fiberfrening somskatteuppskov emcs vidbeskattning avs hrvidfr intebeskrivningar lnanlitaavslut avrutavdragbeskattningekonomisk2015 2014villkor frpantsttningutlndskt fartyg preliminrregistrationrotarbetenstipendierabsolute leftvillkorcolor 168dc4tillgngteckensprkom emcs intep utlndskt fartygskattekontoupplagshavaresetjnsterekonomisk freningswedishopen sansmobiltstllfartyg preliminrp justering frinformation kontakta2013 2012 2011skatt jmkningandrafr ettpersonersoch svar omkapitalinkomsterhardinabestll personbevisfr attoch fav sprrat kontoomvnd skattskyldighetvirtualurlelse ifjquerythishasclassactive countkanrot and rutjanuari 2017omabroadsvar omoss kontaktameraemot i emcsotherother languagesfretag ochtillservicekontora skvnummer omrdewidthskerhetyrkesmssigarbete i sverigeavsndare registreradombudjuni31 december 2016senastavsndarekpa varordin skatt2017 2016iddeklareraombud fremcs vid importvid exportuppgifterfrgorldresprrat9kadeutp elpersonbevisbetala ochopennyheter 2017 2016lagring mm exempelmoving with your21 juni31 decembersvensksktorg och marknadshandelfastigheterfrn lndermedborgarearbetsgivareinkp frnuthyrning avservicesmovingindividualsblockgrmoving by yourselfexempel p justeringinomskattskyldighetunderlineutanfr eu sljafontstylekpa tjnster3vid frsljningmomsinkomst pavsndaresf tillbakasrskildskatteregler avvecklaavregistreraregler frkade levnadskostnaderandra eulndervad remcs om emcsseedoneuropayour family youp demandgarantikvittogvor20 juni 2016vid import tafartygjuni31registernrny i sverigesprrat konto registreradsld senastbosattomprvninga skvnummerregistrerad avsndareverksamhetkakoruttagsbeskattningkonto registreradstockelupplagshavares flyttningsskerhetjuni 2016tvlingsvinsteryou belongkonto upplagshavaresfrgor ochskerhet fr lagringfysiskanoteu sljainkomst p utlndsktyrkesmssig hanteringlanguagesposition absolutebilfrmnid cardnyheter 2017securitieslineheight 12exempelslja varorarbetsgivardeklarationframbostad sld 21terfringmargin 0frskringarhosskerhet frfrgor och svartomtmarkavkastningsskatt pliving2017 2016 2015bolagsjlv duteknisk information kontaktahanteringskattefriapreliminr

Longtail Keyword Density for

p pantsttning av14
exempel p pantsttning14
demandgaranti exempel p14
p demandgaranti exempel14
pantsttning av sprrat14
exempel p demandgaranti14
av sprrat konto14
you are moving12
2017 2016 20159
2015 2014 20138
2016 2015 20147
list-social-links ul li7
flyttar sjlv du6
skerhet exempel p6
sprrat konto registrerad6
sjlv du flyttar6
flyttar med din6
med din familj6
du flyttar sjlv6
lnder utanfr eu6
du flyttar med6
2016 bostad sld6
moving with your6
fretag och arbete6
moving by yourself6
rot- och rutarbete6
2014 2013 20125
ln fr ln5
fr ett fretag4
att tnka p4
nyheter 2017 20164
1 januari 20174
fr ln ldre4
ln ldre beskrivningar4
frn andra eu-lnder4
beskrivningar ln fr4
vrdeomrden beskrivningar ln4
a- skv-nummer omrde4
change of address4
your family you4
frgor och svar4
working in sweden4
kpa tjnster frn4
emcs vid import3
margin 0 padding3
important e-service messages3
emcs vid export3
vid export emcs3
export emcs vid3
rot and rut3
skatt p arbete3
font-family open sans3
emcs tillgng till3
varumottagares skerhet exempel3
open sans semiboldarialsans-serifsans-serif3
flytta under skatteuppskov3
under skatteuppskov emcs3
0 padding 03
position absolute left3
skatteuppskov emcs vid3
vid import ta3
emcs om emcs3
information kontakta oss3
teknisk information kontakta3
tillgngligt teknisk information3
energiskatt p el3
frn lnder utanfr3
varor och tjnster3
registrerad varumottagares skerhet3
ombud fr ett3
r tillgngligt teknisk3
inte r tillgngligt3
driva fiberfrening som3
om emcs inte3
emot i emcs3
inkomst av nringsverksamhet3
till lnder utanfr3
emcs inte r3
utanfr eu slja3
till andra eu-lnder3
import ta emot3
fr lagring mm3
din familj du3
arbete i sverige3
ny i sverige3
fr att f3
villkor fr att3
rot- och rutavdrag3
fr inte vara3
bostad sld senast3
uppskov bostad sld3
vara nrstende till3
inte vara nrstende3
och svar om3
2013 2012 20113
arbetsgivaravgifter och skatteavdrag3
och f tillbaka3
betala och f3
vanliga frgor om3
torg- och marknadshandel3
inkomst p utlndskt3
preliminr skatt jmkning3
fartyg preliminr skatt3
utlndskt fartyg preliminr3
p utlndskt fartyg3
20 juni 20163
juni 2016 bostad3
else ifjquerythishasclassactive count3
skerhet fr lagring3
upplagshavares skerhet fr3
tillflligt registrerad varumottagare3
lagring mm exempel3
mm exempel p3
registrerad avsndares skerhet3
flyttningsskerhet exempel p3
upplagshavares flyttningsskerhet exempel3
sprrat konto upplagshavares3
registrerad avsndare registrerad3
p justering fr3
juni31 december 20163
21 juni31 december3
sld 21 juni313
bostad sld 213
december 2016 bostad3
bostad sld 13
exempel p justering3
2017 eller senare3
januari 2017 eller3
sld 1 januari3
avsndares skerhet exempel3
exempel p32
pantsttning av14
p pantsttning14
p demandgaranti14
av sprrat14
demandgaranti exempel14
sprrat konto14
du flyttar13
2016 201511
2017 201611
rot- och11
frsljning av10
skatt p10
id card9
list-social-links ul9
bostad sld9
2015 20149
beskattning av9
ul li9
2014 20138
kontakta oss7
fr att7
andra eu-lnder7
utanfr eu7
s hr7
rkna ut7
skerhet exempel6
emcs vid6
din familj6
och arbete6
konto registrerad6
f tillbaka6
list-footer-links ul6
2016 bostad6
nr du6
registrerad varumottagare6
fretag och6
your family6
sjlv du6
du ska6
flyttar med6
lnder utanfr6
med din6
tax return6
flyttar sjlv6
och rutarbete6
yourself you6
ombud fr5
ln fr5
digital brevlda5
att f5
1 januari5
fr ln5
under skatteuppskov5
nyheter 20175
fr ett5
avdrag fr5
av utlndsk5
betalning av5
justering av5
2013 20125
kpa tjnster5
av nringsverksamhet5
family you5
vanliga frgor5
skatteregler avveckla4
januari 20174
margin 04
om webbplatsen4
position relative4
position absolute4
viktiga datum4
mina sidor4
alla e-tjnster4
a- skv-nummer4
skv-nummer omrde4
important e-service4
enskild nringsverksamhet4
frn andra4
direkt till4
ldre beskrivningar4
ln ldre4
yrkesmssig hantering4
line-height 124
color 168dc44
list-footer-links ahover4
p el4
lgre skatt4
varor frn4
ett fretag4
av varor4
vrdeomrden beskrivningar4
godknd lagerhllare4
skyldighet att4
tjnster frn4
beskrivningar ln4
och svar4
frgor och4
till andra4
din skatt4
att tnka4
frgor om4
betala och4
tnka p4
med mera4
utomlands bosatta4
skattefria frmner4
har du4
bosatt utomlands4
arbetsgivaravgifter och4
preliminr skatt4
frn utlndska4
resor och4
du har4
sjlvrttelse av4
om oss4
vad r4
text-decoration none3
ersttning till3
frn lnder3
torg- och3
och skatteavdrag3
eu slja3
lmna arbetsgivardeklaration3
slja varor3
omvnd skattskyldighet3
font-style normal3
font-size 16px3
till lnder3
slja tjnster3
inom eu3
inkp frn3
och tjnster3
av skatt3
att lmna3
redovisning av3
som lagerhllare3
terbetalning av3
inkomst p3
other languages3
text-decoration underline3
kpa varor3
varor och3
regler fr3
fr arbete3
och marknadshandel3
oss kontakta3
font-weight normal3
inkomst av3
ifjquerythishasclassactive count3
padding 03
foreign entrepreneurs3
else ifjquerythishasclassactive3
you belong3
skattereduktion fr3
och f3
cash register3
mer om3
list-style none3
deklarerar du3
har deklarerat3
e-service messages3
carte didentit3
0 padding3
s fungerar3
income tax3
ideell frening3
open sans3
driva fiberfrening3
vid utlandsarbete3
fyller du3
sans semiboldarialsans-serifsans-serif3
std vid3
fiberfrening som3
ekonomisk frening3
fysiska personers3
absolute left3
p arbete3
count 33
p utlndskt3
font-family open3
vem ska3
tillgngligt teknisk3
sverige du3
sverige filmer3
skatt att3
familj du3
blanketter broschyrer3
inte vara3
fr inte3
och rutavdrag3
att betala3
debiterad preliminrskatt3
p justering3
justering fr3
nyheter 13
svar om3
avkastningsskatt p3
villkor fr3
bestll personbevis3
avslut av3
vara nrstende3
mobilt bankid3
juni31 december3
december 20163
sld 13
21 juni313
sld 213
20 juni3
juni 20163
uppskov bostad3
vid frsljning3
ska betala3
uthyrning av3
till dig3
nrstende till3
och fastighetsskatt3
betala skatt3
2017 eller3
eller senare3
registrerad avsndare3
avsndare registrerad3
export emcs3
vid import3
import ta3
vid export3
fartyg preliminr3
tillgng till3
flytta under3
skatteuppskov emcs3
ta emot3
emcs om3
teknisk information3
information kontakta3
energiskatt p3
sld senast3
r tillgngligt3
om emcs3
emcs inte3
inte r3
emcs tillgng3
varumottagares skerhet3
lagring mm3
mm exempel3
har rtt3
fr lagring3
skerhet fr3
ansk om3
tillflligt registrerad3
upplagshavares skerhet3
2012 20113
kade levnadskostnader3
registrerad avsndares3
avsndares skerhet3
registrerad varumottagares3
skatt jmkning3
flyttningsskerhet exempel3
konto upplagshavares3
upplagshavares flyttningsskerhet3
utlndskt fartyg3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry Sweden Sweden Sweden